HHsearch results for GI: 254780987 and protein with PDBid: 2h09_A

>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli}
Probab=90.51  E-value=0.22  Score=27.46  Aligned_cols=53  Identities=19%  Similarity=0.156  Sum_probs=38.3

Q ss_pred             CCCCCCHHHHHHHHCCCCCHHHHH---HHHHHCCCCHHHCCCCCCCEEECHHHHHHHHHHH
Q ss_conf             576518999999877788989999---9999879812202577532011611356445642
Q gi|254780987|r   20 NLPYYTPTQLGKKLATKPSAIKVN---KKLREWGFLLEEHESGRKRDVLTPKGAKGGGRYF   77 (110)
Q Consensus        20 ~~~~ltPTqlGk~lg~k~SA~~vN---~lL~~~GlQ~~~~~~grkew~lT~~G~k~g~~~~   77 (110)
                      +.++-+.++|.+.|+  +|...|+   +.|...||-.   ...++.+.||++|++.+..+.
T Consensus        51 ~~~~vr~~dIA~~L~--vs~~sVs~~l~~L~~~GlI~---~~~~~~i~LT~~G~~~A~~i~  106 (155)
T 2h09_A           51 EVGEARQVDMAARLG--VSQPTVAKMLKRLATMGLIE---MIPWRGVFLTAEGEKLAQESR  106 (155)
T ss_dssp             HHSCCCHHHHHHHHT--SCHHHHHHHHHHHHHTTCEE---EETTTEEEECHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHC--CCHHHHHHHHHHHHHCCCEE---ECCCCCEEECHHHHHHHHHHH
T ss_conf             389770999999969--89789999999997788987---549987558985999999999