BLAST/PSIBLAST alignment of GI: 254780987 and GI: 299530348 at iteration 2
>gi|299530348|ref|ZP_07043773.1| hypothetical protein CTS44_06218 [Comamonas testosteroni S44] Length = 255
>gi|298721719|gb|EFI62651.1| hypothetical protein CTS44_06218 [Comamonas testosteroni S44] Length = 255
 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 11/101 (10%)

Query: 7   VNVLQDI---NLPTPNNL-PYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKR 62
           +N++Q +   +L   +    +YTPT+LGK +    SA   N  L E G  ++  E    +
Sbjct: 156 INLMQQLGHTHLEAESQEGQWYTPTELGKVIGA--SARGTNLLLAEAGLQMKLGE----K 209

Query: 63  DVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLA 103
              T  G     R FDTGKK   G  V Q+KW   ++  L 
Sbjct: 210 WEATDAGKD-FCRLFDTGKKHGSGVSVTQMKWSRTVIPLLG 249