RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780987|ref|YP_003065400.1| hypothetical protein CLIBASIA_04440 [Candidatus Liberibacter asiaticus str. psy62] (110 letters) >gnl|CDD|178449 PLN02858, PLN02858, fructose-bisphosphate aldolase. Length = 1378 Score = 28.7 bits (64), Expect = 0.32 Identities = 12/40 (30%), Positives = 18/40 (45%), Gaps = 6/40 (15%) Query: 2 ESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIK 41 E V GVN+L+ N Y P L K++ + +K Sbjct: 292 EKVFGVNILE------AANRELYKPEDLAKQITMQAKPVK 325 >gnl|CDD|179669 PRK03902, PRK03902, manganese transport transcriptional regulator; Provisional. Length = 142 Score = 26.9 bits (60), Expect = 1.1 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Query: 33 LATKPSAI-KVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGR 75 L+ PS++ K+ +KL + +L+ E G VLTPKG K G R Sbjct: 32 LSVHPSSVTKMVQKLDKDEYLIYEKYRGL---VLTPKGKKIGKR 72 >gnl|CDD|182219 PRK10064, PRK10064, catecholate siderophore receptor CirA; Provisional. Length = 663 Score = 26.4 bits (58), Expect = 1.7 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 9/60 (15%) Query: 21 LPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTG 80 LP++T L KP A L +W F + + +G+KR GG ++TG Sbjct: 568 LPFHTAN---GTLDWKPLA------LEDWSFYVSGNYTGQKRADSATAKTPGGYTIWNTG 618 >gnl|CDD|177535 PHA03131, PHA03131, dUTPase; Provisional. Length = 286 Score = 25.3 bits (56), Expect = 3.7 Identities = 10/33 (30%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 13 INLPTPNNLPYYTPTQLGKK-LATKPSAIKVNK 44 ++L P P++ P G+ LA+K +K K Sbjct: 155 LSLCCPPISPHFVPVIFGRSGLASKGLTVKPTK 187 >gnl|CDD|130050 TIGR00977, LeuA_rel, 2-isopropylmalate synthase/homocitrate synthase family protein. This model represents uncharacterized proteins related to 2-isopropylmalate synthases and homocitrate synthases but phylogenetically distint. Each species represented in the seed alignment also has a member of a known family of 2-isopropylmalate synthases. Length = 526 Score = 24.9 bits (54), Expect = 4.4 Identities = 11/36 (30%), Positives = 17/36 (47%) Query: 13 INLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLRE 48 +NLP +N+PY + K SA++ N E Sbjct: 278 VNLPPDDNMPYVGRSAFAHKGGVHVSAVQRNPFTYE 313 >gnl|CDD|163076 TIGR02928, TIGR02928, orc1/cdc6 family replication initiation protein. Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other. Length = 365 Score = 24.5 bits (54), Expect = 5.9 Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Query: 17 TPNNLPYYTPTQLGKKLATKPSAIKVNKKLRE 48 P+N+ Y T GK TK V K+L E Sbjct: 39 RPSNVFIYGKTGTGKTAVTK----YVMKELEE 66 >gnl|CDD|161717 TIGR00118, acolac_lg, acetolactate synthase, large subunit, biosynthetic type. Several isozymes of this enzyme are found in E. coli K12, one of which contains a frameshift in the large subunit gene and is not expressed. Length = 558 Score = 24.3 bits (53), Expect = 6.6 Identities = 11/28 (39%), Positives = 13/28 (46%) Query: 12 DINLPTPNNLPYYTPTQLGKKLATKPSA 39 + P NLP Y PT G L K +A Sbjct: 168 EYPYPEKVNLPGYRPTVKGHPLQIKKAA 195 >gnl|CDD|116082 pfam07461, NADase_NGA, Nicotine adenine dinucleotide glycohydrolase (NADase). This family consists of several bacterial nicotine adenine dinucleotide glycohydrolase (NGA) proteins which appear to be specific to Streptococcus pyogenes. NAD glycohydrolase (NADase) is a potential virulence factor. Streptococcal NADase may contribute to virulence by its ability to cleave beta-NAD at the ribose-nicotinamide bond, depleting intracellular NAD pools and producing the potent vasoactive compound nicotinamide. Length = 446 Score = 24.3 bits (52), Expect = 7.1 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Query: 12 DINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLE--EHESGRKRDVL 65 D+ N L + +LG KP I+++KKL +E E G+ +D+L Sbjct: 130 DVKYYNGNKLVLFHKIELGDTYTKKPHHIEIDKKLDVDRIDIEVTEVHQGQNKDIL 185 >gnl|CDD|162997 TIGR02746, TraC-F-type, type-IV secretion system protein TraC. The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase. Length = 797 Score = 24.2 bits (53), Expect = 7.5 Identities = 8/19 (42%), Positives = 11/19 (57%) Query: 41 KVNKKLREWGFLLEEHESG 59 + KKL+E +L E SG Sbjct: 294 SLEKKLKEIKYLREAIASG 312 >gnl|CDD|185604 PTZ00416, PTZ00416, elongation factor 2; Provisional. Length = 836 Score = 24.2 bits (53), Expect = 7.9 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 11/48 (22%) Query: 63 DVLTPKGAKGG---------GRYFDTGKKRSDGTIVQQIKWHPPIVES 101 D+ P+ A GG G G+++ GT + IK + P+ ES Sbjct: 726 DITAPEDAMGGIYSVLNRRRGVVI--GEEQRPGTPLSNIKAYLPVAES 771 >gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional. Length = 547 Score = 24.2 bits (53), Expect = 8.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Query: 81 KKRSDGTIVQQIKW 94 +KR DGTI I+W Sbjct: 57 RKRQDGTIPWYIRW 70 >gnl|CDD|161830 TIGR00344, alaS, alanine--tRNA ligase. The model describes alanine--tRNA ligase. This enzyme catalyzes the reaction (tRNAala + L-alanine + ATP = L-alanyl-tRNAala + pyrophosphate + AMP). Length = 851 Score = 23.9 bits (52), Expect = 9.0 Identities = 18/77 (23%), Positives = 30/77 (38%), Gaps = 13/77 (16%) Query: 13 INLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVL---TPKG 69 N+ Y + K+ L E G ++E E+G+ V+ TP Sbjct: 446 ANVYPATEFLGYEDLEFEAKV----------IGLFEDGKPVDEAEAGQSVYVILDQTPFY 495 Query: 70 AKGGGRYFDTGKKRSDG 86 A+ GG+ DTG ++ Sbjct: 496 AESGGQIGDTGYLIAND 512 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.314 0.137 0.412 Gapped Lambda K H 0.267 0.0713 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,856,823 Number of extensions: 104369 Number of successful extensions: 154 Number of sequences better than 10.0: 1 Number of HSP's gapped: 154 Number of HSP's successfully gapped: 20 Length of query: 110 Length of database: 5,994,473 Length adjustment: 76 Effective length of query: 34 Effective length of database: 4,352,265 Effective search space: 147977010 Effective search space used: 147977010 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.1 bits)