RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780987|ref|YP_003065400.1| hypothetical protein CLIBASIA_04440 [Candidatus Liberibacter asiaticus str. psy62] (110 letters) >3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} (A:1-91) Length = 91 Score = 28.6 bits (64), Expect = 0.33 Identities = 8/48 (16%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Query: 25 TPTQLGKKLATKPSAI-KVNKKLREWGFLLEEHESGRKRDVLTPKGAK 71 T ++L L + ++ L + G++ + +T KG Sbjct: 29 TSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLD 76 >1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus, viral protein; 2.70A {Sulfolobus virus 1} (A:) Length = 99 Score = 24.2 bits (52), Expect = 6.9 Identities = 13/26 (50%), Positives = 15/26 (57%) Query: 44 KKLREWGFLLEEHESGRKRDVLTPKG 69 K L + GF+ E E G KR LT KG Sbjct: 48 KFLIQEGFVKERQERGEKRLYLTEKG 73 >2w8d_A Processed glycerol phosphate lipoteichoic acid synthase 2; transferase, phosphatase, cell membrane, transmembrane, LTA, WTA, membrane; HET: TPO PG4; 2.35A {Bacillus subtilis} (A:1-24,A:333-436) Length = 128 Score = 24.0 bits (52), Expect = 7.5 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Query: 60 RKRDVLTPKGAKGGGRYFD--TGKKRSDGTIVQQIK 93 R D ++PK K G+Y+D TGK+ + + + Sbjct: 39 RNGDFISPKYTKISGKYYDTKTGKELDESEVDKSED 74 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.314 0.137 0.412 Gapped Lambda K H 0.267 0.0499 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 875,585 Number of extensions: 36373 Number of successful extensions: 58 Number of sequences better than 10.0: 1 Number of HSP's gapped: 58 Number of HSP's successfully gapped: 6 Length of query: 110 Length of database: 4,956,049 Length adjustment: 65 Effective length of query: 45 Effective length of database: 2,758,724 Effective search space: 124142580 Effective search space used: 124142580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.6 bits)