RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780987|ref|YP_003065400.1| hypothetical protein CLIBASIA_04440 [Candidatus Liberibacter asiaticus str. psy62] (110 letters) >d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 Score = 26.5 bits (58), Expect = 0.57 Identities = 14/45 (31%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Query: 31 KKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGR 75 +K + + K R + L EE ES VLT KG G Sbjct: 379 RKEVIRNKIRAIGKMARVFSVLREESES-----VLTLKGLTPTGM 418 >d1j6qa_ b.40.9.1 (A:) Heme chaperone CcmE {Shewanella putrefaciens [TaxId: 24]} Length = 100 Score = 26.5 bits (58), Expect = 0.67 Identities = 7/44 (15%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Query: 23 YYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLT 66 +YTP+++ + +++R G ++ R + L Sbjct: 6 FYTPSEIVNGKTDTGVKPEAGQRIRVGG-MVTVGSMVRDPNSLH 48 >d1sr3a_ b.40.9.1 (A:) Heme chaperone CcmE {Escherichia coli [TaxId: 562]} Length = 114 Score = 26.4 bits (58), Expect = 0.68 Identities = 7/33 (21%), Positives = 15/33 (45%) Query: 23 YYTPTQLGKKLATKPSAIKVNKKLREWGFLLEE 55 +YTP ++ +V ++LR G ++ Sbjct: 8 FYTPGEILYGKRETQQMPEVGQRLRVGGMVMPG 40 >d1q2la3 d.185.1.1 (A:264-503) Protease III {Escherichia coli [TaxId: 562]} Length = 240 Score = 24.6 bits (53), Expect = 2.1 Identities = 8/26 (30%), Positives = 9/26 (34%), Gaps = 2/26 (7%) Query: 22 PYYTPTQLGKKLATKPSAIKVNKKLR 47 P T Q G + P K LR Sbjct: 5 PVVTDAQKGIIIHYVP--ALPRKVLR 28 >d1vr6a1 c.1.10.4 (A:1-338) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} Length = 338 Score = 24.3 bits (52), Expect = 3.0 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 6/49 (12%) Query: 31 KKLATKPSAIKVNKKLREWGFLLEEHES-GRKRDVLTPKGAKGGGRYFD 78 K +T+ KV K + L+ H S G++R V+ G G RY Sbjct: 6 KPGSTEEDIRKVVKLAESYN--LKCHISKGQERTVI---GIIGDDRYVV 49 >d1ppjc2 f.21.1.2 (C:15-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Length = 246 Score = 23.9 bits (52), Expect = 3.8 Identities = 5/12 (41%), Positives = 9/12 (75%) Query: 13 INLPTPNNLPYY 24 I+LP P+N+ + Sbjct: 5 IDLPAPSNISSW 16 >d3cx5c2 f.21.1.2 (C:1-261) Mitochondrial cytochrome b subunit, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 261 Score = 23.2 bits (50), Expect = 6.9 Identities = 4/12 (33%), Positives = 9/12 (75%) Query: 13 INLPTPNNLPYY 24 I+ P P+++ Y+ Sbjct: 18 IDSPQPSSINYW 29 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.314 0.137 0.412 Gapped Lambda K H 0.267 0.0670 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 426,281 Number of extensions: 18264 Number of successful extensions: 24 Number of sequences better than 10.0: 1 Number of HSP's gapped: 24 Number of HSP's successfully gapped: 9 Length of query: 110 Length of database: 2,407,596 Length adjustment: 69 Effective length of query: 41 Effective length of database: 1,460,226 Effective search space: 59869266 Effective search space used: 59869266 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.0 bits)