RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780988|ref|YP_003065401.1| hypothetical protein CLIBASIA_04445 [Candidatus Liberibacter asiaticus str. psy62] (151 letters) >1fft_C Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli} (C:) Length = 204 Score = 27.0 bits (59), Expect = 1.3 Identities = 4/18 (22%), Positives = 9/18 (50%) Query: 94 FTTLFWIILYPLLIWWGV 111 F + WI ++ ++ G Sbjct: 186 FLDVVWICVFTVVYLMGA 203 >1v54_C Cytochrome C oxidase polypeptide III; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} (C:70-261) Length = 192 Score = 26.6 bits (58), Expect = 1.8 Identities = 7/17 (41%), Positives = 10/17 (58%) Query: 94 FTTLFWIILYPLLIWWG 110 F + W+ LY + WWG Sbjct: 175 FVDVVWLFLYVSIYWWG 191 >1m56_C Cytochrome C oxidase; membrane protein, oxidoreductase; HET: HEA PEH; 2.30A {Rhodobacter sphaeroides} (C:71-266) Length = 196 Score = 25.8 bits (56), Expect = 2.3 Identities = 5/17 (29%), Positives = 9/17 (52%) Query: 94 FTTLFWIILYPLLIWWG 110 F + W+ L+ + WG Sbjct: 179 FVDVVWLFLFASIYIWG 195 >1qle_C Cytochrome C oxidase polypeptide III; oxidoreductase/immune system, complex (oxidoreductase/antibody), electron transport; HET: HEA PC1; 3.0A {Paracoccus denitrificans} (C:78-273) Length = 196 Score = 25.8 bits (56), Expect = 2.7 Identities = 5/17 (29%), Positives = 10/17 (58%) Query: 94 FTTLFWIILYPLLIWWG 110 F + W+ L+ ++ WG Sbjct: 179 FVDVVWLFLFVVIYIWG 195 >2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} (Y:) Length = 63 Score = 24.6 bits (53), Expect = 6.7 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Query: 22 NLLEEY--IMKEKSIEHDRLRLEIAKIQSTTQVD 53 LL+ Y + KS E+DRLRL + ++ + VD Sbjct: 22 QLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVD 55 >2bw2_A Bypass of forespore C; sporulation, signaling protein, BOFC, sigmak checkpoint; NMR {Bacillus subtilis} (A:68-140) Length = 73 Score = 23.9 bits (52), Expect = 8.6 Identities = 13/35 (37%), Positives = 16/35 (45%) Query: 33 SIEHDRLRLEIAKIQSTTQVDLKALESETPVRLAR 67 S H R IQS Q+DL+ LES L + Sbjct: 17 STFHGRPEPASEPIQSFFQIDLERLESHMQKNLLK 51 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.328 0.142 0.428 Gapped Lambda K H 0.267 0.0556 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,109,620 Number of extensions: 44914 Number of successful extensions: 132 Number of sequences better than 10.0: 1 Number of HSP's gapped: 131 Number of HSP's successfully gapped: 18 Length of query: 151 Length of database: 4,956,049 Length adjustment: 81 Effective length of query: 70 Effective length of database: 2,217,844 Effective search space: 155249080 Effective search space used: 155249080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (23.8 bits)