RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780988|ref|YP_003065401.1| hypothetical protein CLIBASIA_04445 [Candidatus Liberibacter asiaticus str. psy62] (151 letters) >d1efya2 d.166.1.2 (A:797-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 215 Score = 26.2 bits (57), Expect = 1.2 Identities = 5/62 (8%), Positives = 22/62 (35%), Gaps = 19/62 (30%) Query: 21 FNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETPVRLARLQNQANEDQFERE 80 ++++Y+ + H+ L++ +I R++ + +++ Sbjct: 15 AKIIKQYVKNTHAATHNAYDLKVVEIF-------------------RIEREGESQRYKPF 55 Query: 81 SK 82 + Sbjct: 56 KQ 57 >d1v54c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} Length = 259 Score = 25.8 bits (56), Expect = 1.8 Identities = 7/17 (41%), Positives = 10/17 (58%) Query: 94 FTTLFWIILYPLLIWWG 110 F + W+ LY + WWG Sbjct: 242 FVDVVWLFLYVSIYWWG 258 >d1m56c_ f.25.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit III {Rhodobacter sphaeroides [TaxId: 1063]} Length = 265 Score = 25.1 bits (54), Expect = 2.5 Identities = 5/17 (29%), Positives = 9/17 (52%) Query: 94 FTTLFWIILYPLLIWWG 110 F + W+ L+ + WG Sbjct: 248 FVDVVWLFLFASIYIWG 264 >d1fvga_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Cow (Bos taurus) [TaxId: 9913]} Length = 192 Score = 24.4 bits (52), Expect = 4.5 Identities = 9/32 (28%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Query: 123 LLAPF---TQDIIACILGFWFTDTIVQRRKGV 151 + PF TQ + + FW + KGV Sbjct: 29 TVEPFPEGTQMAVFGMGCFWGAERKFWTLKGV 60 >d1fftc_ f.25.1.1 (C:) Cytochrome O ubiquinol oxidase, subunit III {Escherichia coli [TaxId: 562]} Length = 185 Score = 24.3 bits (52), Expect = 4.6 Identities = 4/17 (23%), Positives = 9/17 (52%) Query: 94 FTTLFWIILYPLLIWWG 110 F + WI ++ ++ G Sbjct: 168 FLDVVWICVFTVVYLMG 184 >d2i5nl1 f.26.1.1 (L:1-273) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]} Length = 273 Score = 23.9 bits (52), Expect = 5.6 Identities = 7/28 (25%), Positives = 13/28 (46%) Query: 83 AMIFFNALIRPFTTLFWIILYPLLIWWG 110 ++I + A P F I + P + +G Sbjct: 47 SLIGYAASQGPTWDPFAISINPPDLKYG 74 >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Score = 23.9 bits (51), Expect = 6.4 Identities = 17/118 (14%), Positives = 31/118 (26%), Gaps = 12/118 (10%) Query: 13 FIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVD-----LKALESETPVRLAR 67 F+ + L E H+ + S L + + V A+ Sbjct: 4 FVDWNGPCLRLQYPLFDIEYLRSHEIYSGTPIQSISLRTNSPQPTSLTSDNDTSSVTTAK 63 Query: 68 LQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGVEKGYLTKDPLTLLA 125 LQ+ + E A+ P + + +I Y +L L Sbjct: 64 LQSILFSNYMEEYKVDFKRSTAIYNPMSEIGKLIEY-------SCLVFLPSPYAEQLK 114 >d2d32a1 d.128.1.4 (A:1-518) Gamma-glutamylcysteine synthetase GshA {Escherichia coli [TaxId: 562]} Length = 518 Score = 23.4 bits (50), Expect = 8.1 Identities = 8/42 (19%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Query: 62 PVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILY 103 P+ + ++ +E + +F +IR + W+I Y Sbjct: 156 PMAFWQAKSGDISGADAKEKISAGYF-RVIRNYYRFGWVIPY 196 >d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 308 Score = 23.3 bits (50), Expect = 8.8 Identities = 4/25 (16%), Positives = 9/25 (36%) Query: 60 ETPVRLARLQNQANEDQFERESKAM 84 P + ++ + +SK M Sbjct: 272 SIPETEIYIMENSDFGEVLEKSKRM 296 >d2etda1 a.29.9.1 (A:35-183) Hypothetical protein TM0961 {Thermotoga maritima [TaxId: 2336]} Length = 149 Score = 23.4 bits (50), Expect = 9.0 Identities = 13/61 (21%), Positives = 23/61 (37%) Query: 15 KFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETPVRLARLQNQANE 74 +P+L ++ Y EK I + I + T + ++E L+RL A Sbjct: 24 DLIPNLVETVKGYAAHEKEILEEIANARAKLIGAKTPQESAQADAELSSALSRLLAIAEN 83 Query: 75 D 75 Sbjct: 84 Y 84 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.328 0.142 0.428 Gapped Lambda K H 0.267 0.0603 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 554,716 Number of extensions: 23516 Number of successful extensions: 68 Number of sequences better than 10.0: 1 Number of HSP's gapped: 68 Number of HSP's successfully gapped: 16 Length of query: 151 Length of database: 2,407,596 Length adjustment: 78 Effective length of query: 73 Effective length of database: 1,336,656 Effective search space: 97575888 Effective search space used: 97575888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (22.9 bits)