BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780988|ref|YP_003065401.1| hypothetical protein CLIBASIA_04445 [Candidatus Liberibacter asiaticus str. psy62] (151 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780988|ref|YP_003065401.1| hypothetical protein CLIBASIA_04445 [Candidatus Liberibacter asiaticus str. psy62] Length = 151 Score = 307 bits (786), Expect = 6e-86, Method: Compositional matrix adjust. Identities = 151/151 (100%), Positives = 151/151 (100%) Query: 1 MISFLTGSIARFFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESE 60 MISFLTGSIARFFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESE Sbjct: 1 MISFLTGSIARFFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESE 60 Query: 61 TPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGVEKGYLTKDP 120 TPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGVEKGYLTKDP Sbjct: 61 TPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGVEKGYLTKDP 120 Query: 121 LTLLAPFTQDIIACILGFWFTDTIVQRRKGV 151 LTLLAPFTQDIIACILGFWFTDTIVQRRKGV Sbjct: 121 LTLLAPFTQDIIACILGFWFTDTIVQRRKGV 151 >gi|254781199|ref|YP_003065612.1| hypothetical protein CLIBASIA_05530 [Candidatus Liberibacter asiaticus str. psy62] Length = 157 Score = 160 bits (406), Expect = 6e-42, Method: Compositional matrix adjust. Identities = 79/158 (50%), Positives = 114/158 (72%), Gaps = 15/158 (9%) Query: 3 SFLTGSIARFFIKFVPSLF----NLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALE 58 SFL G + RF ++F+PS F +++ EY+ K++SIE+D+L+LE+AK S+TQ+DL ++ Sbjct: 4 SFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIK 63 Query: 59 S-------ETPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGV 111 + + P+RLAR++ Q + + K + F ALIRP TT FWII+YPLL+WW V Sbjct: 64 AGIEELKIDKPIRLARIEAQ----KVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSV 119 Query: 112 EKGYLTKDPLTLLAPFTQDIIACILGFWFTDTIVQRRK 149 ++G DPLTLL+PFTQ+IIACILGFW+TD IVQ++K Sbjct: 120 KEGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK 157 >gi|254780356|ref|YP_003064769.1| hypothetical protein CLIBASIA_01205 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Score = 23.1 bits (48), Expect = 2.6, Method: Compositional matrix adjust. Identities = 10/35 (28%), Positives = 15/35 (42%) Query: 76 QFERESKAMIFFNALIRPFTTLFWIILYPLLIWWG 110 Q E+E F + F +FW + P + WG Sbjct: 22 QLEQEYGGFFLFIPVFLAFGAIFWFVYSPEIPIWG 56 >gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter asiaticus str. psy62] Length = 853 Score = 21.6 bits (44), Expect = 6.1, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Query: 16 FVPSLFNLLEEYIMKEKSIEHDR---LRLEIAKIQS 48 F P N L+E I+ EK + D +R+++ ++ S Sbjct: 744 FKPEFLNRLDEIILFEKLRKEDMAKIVRIQLGRVLS 779 >gi|254780902|ref|YP_003065315.1| isocitrate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 412 Score = 21.6 bits (44), Expect = 6.5, Method: Compositional matrix adjust. Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 111 VEKGYLTKDPLTLLAP 126 VE G++TKD L+ P Sbjct: 365 VEDGFMTKDLALLIGP 380 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.328 0.142 0.428 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,690 Number of Sequences: 1233 Number of extensions: 3079 Number of successful extensions: 11 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 6 length of query: 151 length of database: 328,796 effective HSP length: 67 effective length of query: 84 effective length of database: 246,185 effective search space: 20679540 effective search space used: 20679540 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 34 (17.7 bits)