RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780989|ref|YP_003065402.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] (185 letters) >gnl|CDD|179611 PRK03624, PRK03624, putative acetyltransferase; Provisional. Length = 140 Score = 31.4 bits (72), Expect = 0.15 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 10/49 (20%) Query: 66 FVCRDGDRIVGAIRATPIQIGKYKGFLRG---PLGVLSEYRKRGIGSRL 111 V G +VG + +G Y G RG L V ++R RGIG L Sbjct: 48 LVAEVGGEVVGTV------MGGYDGH-RGWAYYLAVHPDFRGRGIGRAL 89 >gnl|CDD|150404 pfam09724, DUF2036, Uncharacterized conserved protein (DUF2036). This family of proteins includes members ranging in size from approximately 300 to 460 residues. There are a number of well-conserved domains along the length. Length = 325 Score = 30.0 bits (68), Expect = 0.36 Identities = 16/77 (20%), Positives = 31/77 (40%), Gaps = 5/77 (6%) Query: 14 LTFANEQRVDQVAVD-EVMVKAFLS---TQEITDDVLHKYVRNNVEEPLSFVRLMSFVCR 69 L + D V + +V+A +E+ + VL+K+ EE F VCR Sbjct: 175 LVLLDSNSWDLDEVSLDEVVEALRPSEYPEEVIETVLNKFGTKESEEGDRFALDEDKVCR 234 Query: 70 D-GDRIVGAIRATPIQI 85 ++++ A + + Sbjct: 235 WFAEQLLQKGLAGKMNL 251 >gnl|CDD|181103 PRK07757, PRK07757, acetyltransferase; Provisional. Length = 152 Score = 29.4 bits (67), Expect = 0.58 Identities = 14/58 (24%), Positives = 19/58 (32%), Gaps = 27/58 (46%) Query: 66 FVCRDGDRIVGA------------IRATPIQIGKYKGFLRGPLGVLSEYRKRGIGSRL 111 +V + IVG IR+ L V +YR +GIG L Sbjct: 44 YVAEEEGEIVGCCALHILWEDLAEIRS---------------LAVSEDYRGQGIGRML 86 >gnl|CDD|182261 PRK10137, PRK10137, alpha-glucosidase; Provisional. Length = 786 Score = 28.2 bits (63), Expect = 1.4 Identities = 13/44 (29%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Query: 140 GFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIGKMSLRRE 183 GF Q +Y GG +DW V +N + + SL +E Sbjct: 534 GFIDKEQLD-KYVANGGKRSDWTVKFAENRSQDGTLLGYSLLQE 576 >gnl|CDD|182877 PRK10975, PRK10975, TDP-fucosamine acetyltransferase; Provisional. Length = 194 Score = 27.6 bits (62), Expect = 2.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 94 GPLGVLSEYRKRGIGSRL 111 G L V + RGIG+RL Sbjct: 130 GLLAVFPGAQGRGIGARL 147 >gnl|CDD|183334 PRK11836, PRK11836, deubiquitinase; Provisional. Length = 403 Score = 26.9 bits (59), Expect = 3.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Query: 43 DDVLHKYVRNNVEEPLSFVRLMSFVC 68 +D+L+ VRN E LS +RL+ C Sbjct: 65 EDILYHIVRNPTNETLSIIRLIKNAC 90 >gnl|CDD|182544 PRK10555, PRK10555, aminoglycoside/multidrug efflux system; Provisional. Length = 1037 Score = 26.3 bits (58), Expect = 4.6 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 11/36 (30%) Query: 30 VMVKAFLST------QEITDDVLHKYVRNNVEEPLS 59 ++ AF+ST Q+I D YV +N+++PLS Sbjct: 137 ILTIAFVSTDGSMDKQDIAD-----YVASNIQDPLS 167 >gnl|CDD|183675 PRK12678, PRK12678, transcription termination factor Rho; Provisional. Length = 672 Score = 26.0 bits (58), Expect = 5.3 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 12/47 (25%) Query: 44 DVLHKY--VR--------NNVEEPLSFVRLMSFVCRDGDRIVGAIRA 80 DVL Y VR N+V ++ VR R GD + GA+RA Sbjct: 301 DVLDNYAFVRTSGYLPGPNDVYVSMNQVRKNGL--RKGDAVTGAVRA 345 >gnl|CDD|173036 PRK14572, PRK14572, D-alanyl-alanine synthetase A; Provisional. Length = 347 Score = 26.0 bits (57), Expect = 5.6 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 6/48 (12%) Query: 19 EQRVDQVAV-----DEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFV 61 EQ + +A+ +VM ++FLS E++ VL +Y R P++ Sbjct: 194 EQLMTLLALIFESDSKVMSQSFLSGTEVSCGVLERY-RGGKRNPIALP 240 >gnl|CDD|150001 pfam09159, Ydc2-catalyt, Mitochondrial resolvase Ydc2, catalytic. Members of this family adopt a secondary structure consisting of two beta sheets and one alpha helix, arranged as a beta-alpha-beta motif. Each beta sheet has five strands, arranged in a 32145 order, with the second strand being antiparallel to the rest. They are capable of resolving Holliday junctions and cleave DNA after 5'-CT-3' and 5'-TT-3' sequences. Length = 253 Score = 25.8 bits (57), Expect = 5.8 Identities = 12/42 (28%), Positives = 20/42 (47%), Gaps = 7/42 (16%) Query: 138 HLGFKKPHQHQI---RYAHGGGAAT-DWLVHIFKNNIMENMI 175 L KP I R+ GG +A +W + N++E+M+ Sbjct: 74 LLLPYKPTHVLIERQRFRSGGSSAVLEW---TLRVNMLESML 112 >gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter. This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc. Length = 708 Score = 25.5 bits (56), Expect = 8.1 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 8/62 (12%) Query: 32 VKAFLST---QEITDDVLHKYVRNNVEEPLSFV---RLMSFVCR--DGDRIVGAIRATPI 83 ++ FL Q ++ D++ Y+++ E P+SF R V R D I+ A+ +T + Sbjct: 215 IQIFLLNVLGQRLSIDIILSYIKHLFELPMSFFSTRRTGEIVSRFTDASSIIDALASTIL 274 Query: 84 QI 85 + Sbjct: 275 SL 276 >gnl|CDD|162142 TIGR00975, 3a0107s03, phosphate ABC transporter, phosphate-binding protein. This family represents one type of (periplasmic, in Gram-negative bacteria) phosphate-binding protein found in phosphate ABC (ATP-binding cassette) transporters. This protein is accompanied, generally in the same operon, by an ATP binding protein and (usually) two permease proteins. Length = 314 Score = 25.5 bits (56), Expect = 9.0 Identities = 11/22 (50%), Positives = 15/22 (68%) Query: 111 LAYMSFMAIKNSGAEFVLIDAK 132 +SF A+KNS +FVL DA+ Sbjct: 201 QNKLSFAALKNSAGKFVLPDAE 222 >gnl|CDD|150336 pfam09635, MetRS-N, MetRS-N binding domain. The MetRS-N domain binds an Arc1-P domain in a tetrameric complex resembling a classical GST homo-dimer. Domain-swapping between symmetrically related MetRS-N and Arc1p-N domains generates a 2:2 tetramer held together by van der Waals forces. This domain is necessary for formation of the aminoacyl-tRNA synthetase complex necessary for tRNA nuclear export and shuttling as part of the translational apparatus. The domain is associated with pfam09334. Length = 122 Score = 25.2 bits (55), Expect = 9.3 Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query: 40 EITDDVLHKYVRNNVEEPLSFVRLMSF 66 E+T+ L Y+ + +EPL+ RL+ F Sbjct: 93 ELTNKSLENYL-VSKKEPLTATRLIVF 118 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.139 0.416 Gapped Lambda K H 0.267 0.0670 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,093,146 Number of extensions: 193971 Number of successful extensions: 348 Number of sequences better than 10.0: 1 Number of HSP's gapped: 347 Number of HSP's successfully gapped: 24 Length of query: 185 Length of database: 5,994,473 Length adjustment: 88 Effective length of query: 97 Effective length of database: 4,092,969 Effective search space: 397017993 Effective search space used: 397017993 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.7 bits)