RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780990|ref|YP_003065403.1| hypothetical protein CLIBASIA_04455 [Candidatus Liberibacter asiaticus str. psy62] (66 letters) >gnl|CDD|147962 pfam06087, Tyr-DNA_phospho, Tyrosyl-DNA phosphodiesterase. Covalent intermediates between topoisomerase I and DNA can become dead-end complexes that lead to cell death. Tyrosyl-DNA phosphodiesterase can hydrolyse the bond between topoisomerase I and DNA. Length = 433 Score = 26.2 bits (58), Expect = 2.0 Identities = 12/37 (32%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Query: 13 FEEDLFQY----DANKSELVLISSLWSIDFFEINCAL 45 F+ DL +Y A LI L DF +N L Sbjct: 155 FKRDLLEYLSEYGAKTLLEPLIDRLRKYDFSSVNVEL 191 >gnl|CDD|165447 PHA03176, PHA03176, UL43 envelope protein; Provisional. Length = 420 Score = 24.1 bits (52), Expect = 7.7 Identities = 8/29 (27%), Positives = 13/29 (44%) Query: 2 FLVPDDGIDDLFEEDLFQYDANKSELVLI 30 +P D +EED+ +D K + I Sbjct: 254 RTIPSPDADATYEEDVSSFDTAKGHIPSI 282 >gnl|CDD|178050 PLN02431, PLN02431, ferredoxin--nitrite reductase. Length = 587 Score = 24.0 bits (52), Expect = 8.6 Identities = 6/16 (37%), Positives = 9/16 (56%) Query: 4 VPDDGIDDLFEEDLFQ 19 VP+ ++ L E L Q Sbjct: 440 VPNSKVEALLAEPLLQ 455 >gnl|CDD|149329 pfam08206, OB_RNB, Ribonuclease B OB domain. This family includes the N-terminal OB domain found in ribonuclease B proteins in one or two copies. Length = 58 Score = 24.0 bits (53), Expect = 8.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Query: 2 FLVPDDGIDDLF 13 FL+PDD DD+F Sbjct: 12 FLIPDDEEDDIF 23 >gnl|CDD|134328 PRK00587, PRK00587, hypothetical protein; Provisional. Length = 99 Score = 24.1 bits (52), Expect = 9.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Query: 13 FEEDLFQYDANKSELVLISSLWSIDFFEINCALL 46 FEE F +D K L+ I +I+ EIN L+ Sbjct: 24 FEEKEFDFDYKKYILIKIKGNLNIEKIEINKELI 57 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.326 0.144 0.442 Gapped Lambda K H 0.267 0.0704 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,139,730 Number of extensions: 53857 Number of successful extensions: 140 Number of sequences better than 10.0: 1 Number of HSP's gapped: 140 Number of HSP's successfully gapped: 10 Length of query: 66 Length of database: 5,994,473 Length adjustment: 37 Effective length of query: 29 Effective length of database: 5,194,977 Effective search space: 150654333 Effective search space used: 150654333 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.1 bits)