>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins. Ncd is a spindle motor protein necessary for chromosome segregation in meiosis. KIFC2/KIFC3-like kinesins have been implicated in motility of the Golgi apparatus as well as dentritic and axonal transport in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found at the C-terminus (C-type). C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for mi

Probab=96.79 E-value=0.003 Score=42.86 Aligned_cols=84 Identities=21% Similarity=0.298 Sum_probs=55.9 Q ss_pred CCEEEEECCCCCCCHHHHHH---HHHHHHHCCCCEE-EEEEECCCCHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHH Q ss_conf 75477518888884389999---9999887397337-9986337646999999999719978999316346899999999 Q gi|254780991|r 139 TFFQMQTDYHPSGDQPAAIA---QLLKGIHSREKVQ-LLLGVTGSGKTFTMAKVIEAMQRPAIVMAPNKILAAQLYSEFK 214 (805) Q Consensus 139 ~~f~l~~~~~P~gdQ~~Ai~---~L~~~l~~g~~~q-lL~GVTGSGKTevya~lI~~~gr~aLvLvPei~La~QL~~rfk 214 (805) T Consensus 45 ~~f~FD~Vf~~~~tQ~~vy~~v~plv~~~l~G~n~ti~aYGqTGSGKTyTm~G~-----------~~~~Giipr~~~~lf 113 (329) T cd01366 45 KSFSFDRVFDPDASQEDVFEEVSPLVQSALDGYNVCIFAYGQTGSGKTYTMEGP-----------PENPGIIPRALEQLF 113 (329) T ss_pred EEEECCEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCEEECCC-----------CCCCCCHHHHHHHHH T ss_conf 077768673999998999999999999986777248996478999985472667-----------887780899999999 Q ss_pred HHC---CCC--EEEEEEECCCCCC Q ss_conf 867---898--3899862134444 Q gi|254780991|r 215 NFF---PHN--AVEYFVSYYDYYQ 233 (805) Q Consensus 215 ~~F---p~n--~V~~f~S~~~~yq 233 (805) T Consensus 114 ~~i~~~~~~~~~~~v~vS~~EIYn 137 (329) T cd01366 114 NTAEELKEKGWSYTITASMLEIYN 137 (329) T ss_pred HHHHHHHCCCCEEEEEEEEEEEEC T ss_conf 999851136832899999998508

HHsearch alignment for GI: 254780991 and conserved domain: cd01366