>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase; InterPro: IPR014166 The tol-pal system consists of five critical genes. Inner membrane proteins TolQ and TolR convert proton motive force to energy that is transduced through TolA to an outer membrane complex of TolB and Pal. The system is known to be required to maintain outer membrane integrity. In a system with several homologous parts, ExbB and ExbD transduces energy through TonB to a variety of outer membrane proteins, many of which are siderophore receptors. The tol-pal system therefore may also be involved in transport. This family consists of a protein nearly always found in operons with the genes of the tol-pal system. The significance of this thioesterase to the tol-pal system is unclear, but either of two observations may be relevant. First, Pal, or peptidoglycan-associated lipoprotein, has a conserved N-terminal cleavage and acylation that makes it a lipoprotein. Second, the tol-pal system is implicated not only in the import of certain organics but also in the maintenance of outer membrane integrity (by an unknown mechanism) ..

Probab=98.09 E-value=5e-05 Score=49.04 Aligned_cols=88 Identities=22% Similarity=0.220 Sum_probs=65.4 Q ss_pred HHHHHHHHHHHHH-CCCCCEEEEEEEEEEECCCCCCCEEEEEEEEEEECCCEEEEEEEEEEECCCCCCCEEEEEEEEEEE Q ss_conf 9999999999997-389832557520343214675738999999996216507999999995377888608999999999 Q gi|254780992|r 58 QIDIACGIRASQL-CKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVV 136 (152) Q Consensus 58 ~~D~aa~~~A~~~-~~~~~vt~~id~i~F~~Pv~~Gd~l~~~a~V~~~G~tSm~V~V~V~~~~~~~~~~~~~~v~~a~fT 136 (152) T Consensus 34 wLR~lG~~Q-~l~~~~g~~FVVr~~~~dy~~PArlDD~L~V~t~~~~~~~Asl~f~Q~v~~~---Rg~---~~L~~A~V~ 106 (127) T TIGR02799 34 WLRALGFEQ-TLLEETGLVFVVRSMELDYLKPARLDDLLTVTTRVVELKGASLVFAQEVRNK---RGD---TLLVEATVE 106 (127) T ss_pred HHHHCCCCC-HHHHCCCCEEEEEEEEEEECCCCCCCCEEEEEEEEEEECCEEEEEEEEEEEC---CCC---EEEEEEEEE T ss_conf 786357210-3575499499998987510587354861589999986447479999999967---898---888888799 Q ss_pred EEEECC-CCCCCCCCCC Q ss_conf 999878-9880227999 Q gi|254780992|r 137 MVAVDE-KGNPKSIRTE 152 (152) Q Consensus 137 fVavDe-~g~P~pip~e 152 (152) T Consensus 107 ~aCv~~~~~rP~~lP~~ 123 (127) T TIGR02799 107 VACVDASDMRPRRLPAE 123 (127) T ss_pred EEEEECCCCCCCCCCHH T ss_conf 99972689897048978

HHsearch alignment for GI: 254780992 and conserved domain: TIGR02799