BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780992|ref|YP_003065405.1| acyl-CoA hydrolase [Candidatus Liberibacter asiaticus str. psy62] (152 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780992|ref|YP_003065405.1| acyl-CoA hydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 152 Score = 310 bits (794), Expect = 7e-87, Method: Compositional matrix adjust. Identities = 152/152 (100%), Positives = 152/152 (100%) Query: 1 MVDISKNINLLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQID 60 MVDISKNINLLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQID Sbjct: 1 MVDISKNINLLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQID 60 Query: 61 IACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPR 120 IACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPR Sbjct: 61 IACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPR 120 Query: 121 NASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152 NASSDVLQKTCEATVVMVAVDEKGNPKSIRTE Sbjct: 121 NASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152 >gi|254780127|ref|YP_003064540.1| putative DNA polymerase from bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62] Length = 675 Score = 23.5 bits (49), Expect = 1.6, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 22/39 (56%) Query: 14 NIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFG 52 NI + L++ ++ SSG LK+ T+ V+ DG + G Sbjct: 269 NITQLAKDLILNRLASSGSAILKLNTLSEAVSSDGRLRG 307 >gi|254780655|ref|YP_003065068.1| transketolase [Candidatus Liberibacter asiaticus str. psy62] Length = 673 Score = 22.3 bits (46), Expect = 3.8, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 15/26 (57%) Query: 62 ACGIRASQLCKCRVVTKAVTELLFEK 87 AC I +S+ RVV+ EL FE+ Sbjct: 576 ACEILSSRNISTRVVSVPCFELFFEQ 601 >gi|254781017|ref|YP_003065430.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 324 Score = 21.6 bits (44), Expect = 6.7, Method: Compositional matrix adjust. Identities = 8/28 (28%), Positives = 17/28 (60%) Query: 32 VLTLKIQTMPTDVNLDGNVFGGWIMSQI 59 + LK+Q + + ++L ++ GG I Q+ Sbjct: 137 AIVLKVQGISSGIDLAASIHGGLICYQM 164 >gi|254780489|ref|YP_003064902.1| 3-oxoacyl-(acyl carrier protein) synthase II [Candidatus Liberibacter asiaticus str. psy62] Length = 325 Score = 21.2 bits (43), Expect = 9.5, Method: Compositional matrix adjust. Identities = 7/14 (50%), Positives = 10/14 (71%) Query: 119 PRNASSDVLQKTCE 132 P A+S ++QK CE Sbjct: 253 PHQANSRIIQKVCE 266 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.134 0.397 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,700 Number of Sequences: 1233 Number of extensions: 2858 Number of successful extensions: 8 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 7 length of query: 152 length of database: 328,796 effective HSP length: 67 effective length of query: 85 effective length of database: 246,185 effective search space: 20925725 effective search space used: 20925725 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 34 (17.7 bits)