HHsearch alignment for GI: 254780993 and conserved domain: COG2119

>COG2119 Predicted membrane protein [Function unknown].
Probab=97.89  E-value=0.0011  Score=37.41  Aligned_cols=149  Identities=17%  Similarity=0.152  Sum_probs=93.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             28855356665456764699999776403663102235899999999997215787743333234013321156766766
Q gi|254780993|r   92 HGTINMKILKDWIFVLPITTVVTSLMISHVDKSFLNKAFAIFCLLMGILMLKRDRLYCERKFPDNYVKYIWGMVTGFLSG  171 (279)
Q Consensus        92 ~~~i~~~~~~~l~~~~~~Ga~lGa~l~~~i~~~~l~~~f~v~ll~~a~~~~~~~~~~~~~~~~~~~~~~~~g~~~G~~sg  171 (279)
T Consensus        33 ~~~v~~g~~~a~~~m~~la~~vG~~~~~~~~~~~~~~~~~~~Flafav~~l~edk~~~~e~~~~~~~~------------  100 (190)
T COG2119          33 RWPVFAGIAIALFAMHALAVLVGHAAASLLPERPLAWASGVLFLAFAVWMLIEDKEDDEEAQAASPRG------------  100 (190)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC------------
T ss_conf             80037999999999999999998887514844579999999999999998066221311334455404------------


Q ss_pred             HHHCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             65211266899999984898446346667888666778999998538764357451001899999999999999999999
Q gi|254780993|r  172 ALGVGGGIFTNLLMLFYGASIYKATATSAGVSALIAFPALLVRIYSGWGLNGLPPWSLGFVNIGAVLIILPISILITPLA  251 (279)
Q Consensus       172 l~GiGGG~l~vp~l~~~g~~~~~avgTS~~~~~~~a~~g~i~~~~~G~~~~~~~~~~~G~v~~~~~~~i~~~s~~ga~iG  251 (279)
T Consensus       101 ---~f~~tfi~~FlaE~GD--KTQiATI-------------a--LaA~--~~~~-~~---V~~Gt~lg~~l~s~laVl~G  154 (190)
T COG2119         101 ---VFVTTFITFFLAELGD--KTQIATI-------------A--LAAD--YHSP-WA---VFAGTTLGMILASVLAVLLG  154 (190)
T ss_pred             ---HHHHHHHHHHHHHHCC--HHHHHHH-------------H--HHHC--CCCC-EE---EEHHHHHHHHHHHHHHHHHH
T ss_conf             ---8999999999999553--8899999-------------9--9603--7996-56---61634899999988999977


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             999830899999999999999999872
Q gi|254780993|r  252 TKLSYMIGKKYLTIGFSMIMFTTSFVF  278 (279)
Q Consensus       252 a~l~~~l~~~~lk~~f~i~l~~v~~~m  278 (279)
T Consensus       155 ~~ia~ki~~r~l~~~aallFl~fal~~  181 (190)
T COG2119         155 KLIAGKLPERLLRFIAALLFLIFALVL  181 (190)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             998711788999999999999999999