BLAST/PSIBLAST alignment of GI: 254780993 and GI: 227822290 at iteration 1
>gi|227822290|ref|YP_002826261.1| protein of unknown function DUF81 [Sinorhizobium fredii NGR234] Length = 273
>gi|227341290|gb|ACP25508.1| protein of unknown function DUF81 [Sinorhizobium fredii NGR234] Length = 273
 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 99/248 (39%), Positives = 156/248 (62%), Gaps = 1/248 (0%)

Query: 32  LSGTLSGLFGVGGGLVMVPVLSKAFQLMGIDDSICMHVAMGTSLGVIAPTSVMSFMEHRR 91
           +SG L+GLFGVGGG ++VPV  + F L+G+DD++ MH+++GTS  +I PTSV SF+ H R
Sbjct: 20  VSGVLAGLFGVGGGAILVPVFFQVFGLLGVDDAVRMHLSVGTSTAIIVPTSVRSFLLHYR 79

Query: 92  HGTINMKILKDWIFVLPITTVVTSLMISHVDKSFLNKAFAIFCLLMGILML-KRDRLYCE 150
            G ++  +L++WI  +P+  ++ +++ ++V    L   FA+  L + + M+  R      
Sbjct: 80  RGVVDTALLRNWILAIPLGAILATVIAAYVSSETLRLIFAMIALAVALRMIFNRATWRLG 139

Query: 151 RKFPDNYVKYIWGMVTGFLSGALGVGGGIFTNLLMLFYGASIYKATATSAGVSALIAFPA 210
           R  P N + ++ G+V G LSG +GVGGG+  N  M  Y   I++A ATS+GV  LI+ P 
Sbjct: 140 RDLPKNPITWLVGVVIGVLSGLMGVGGGVLNNTFMTLYNRPIHEAIATSSGVGVLISIPG 199

Query: 211 LLVRIYSGWGLNGLPPWSLGFVNIGAVLIILPISILITPLATKLSYMIGKKYLTIGFSMI 270
           L   I++G G  GLPP S GFVN  AV +I+P+S+L+ PL  +L++ + ++ L  GF + 
Sbjct: 200 LFGYIWAGSGEPGLPPLSTGFVNWIAVALIIPVSLLVAPLGVRLAHAMDRRQLEAGFGIF 259

Query: 271 MFTTSFVF 278
           M   +  F
Sbjct: 260 MILIALRF 267