RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780993|ref|YP_003065406.1| hypothetical protein CLIBASIA_04470 [Candidatus Liberibacter asiaticus str. psy62] (279 letters) >2dg5_A Gamma-glutamyltranspeptidase; gamma-glutamyltransferase, GGT, gamma-GT, glutathione; HET: GLU; 1.60A {Escherichia coli K12} (A:253-366) Length = 114 Score = 28.4 bits (63), Expect = 0.98 Identities = 10/26 (38%), Positives = 15/26 (57%) Query: 216 YSGWGLNGLPPWSLGFVNIGAVLIIL 241 Y G+ + PP S G ++I +L IL Sbjct: 6 YRGYQVYSXPPPSSGGIHIVQILNIL 31 >2v36_A Gamma-glutamyltranspeptidase large chain; transferase, glutathione biosynthesis, gamma-glutamyl transferase, acyltransferase, zymogen; 1.85A {Bacillus subtilis} (A:249-376) Length = 128 Score = 27.2 bits (60), Expect = 2.5 Identities = 8/26 (30%), Positives = 13/26 (50%) Query: 216 YSGWGLNGLPPWSLGFVNIGAVLIIL 241 Y G+ + PP S G + + + IL Sbjct: 6 YQGYQIATTPPPSSGGIFLLQMPKIL 31 >2z9e_A Cellulose synthase operon protein D; alpha and beta fold, octamer, tetramer of dimers, molecule ring, cellulose biosynthesis; 2.50A {Acetobacter xylinus} PDB: 2z9f_A (A:38-167) Length = 130 Score = 26.4 bits (58), Expect = 4.0 Identities = 6/21 (28%), Positives = 9/21 (42%) Query: 199 SAGVSALIAFPALLVRIYSGW 219 SAG + +L +Y W Sbjct: 69 SAGEPSGTWLAPVLEGLYGRW 89 >3fay_A P195, RAS GTPase-activating-like protein iqgap1; all alpha, calmodulin-binding, cell membrane, membrane, phosphoprotein, membrane protein; 2.20A {Homo sapiens} (A:103-326) Length = 224 Score = 26.5 bits (58), Expect = 4.4 Identities = 5/24 (20%), Positives = 9/24 (37%) Query: 146 RLYCERKFPDNYVKYIWGMVTGFL 169 + KFPD + ++ L Sbjct: 108 KDSLHEKFPDAGEDELLKIIGNLL 131 >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} (A:41-122,A:180-297) Length = 200 Score = 26.1 bits (57), Expect = 5.7 Identities = 7/56 (12%), Positives = 17/56 (30%), Gaps = 4/56 (7%) Query: 42 VGGGLVMVPVLSKAFQLMGIDDSICMHVAMGTSLGVIAPT----SVMSFMEHRRHG 93 +G G+ + P +A +G+ ++ L I + + Sbjct: 3 LGVGINIQPAAVEALAELGLGPALAATAIPTHELRYIDQSGATVWSEPRGVEAGNA 58 >2qmc_A GGT, gamma-glutamyltranspeptidase; NTN-hydrolase, transferase; HET: GTB; 1.55A {Helicobacter pylori} PDB: 2qm6_A* 3fnm_A* 2nqo_A (A:264-377) Length = 114 Score = 25.7 bits (56), Expect = 6.7 Identities = 6/26 (23%), Positives = 14/26 (53%) Query: 216 YSGWGLNGLPPWSLGFVNIGAVLIIL 241 Y G+ + + P S G ++ +L ++ Sbjct: 6 YRGYKIISMSPPSSGGTHLIQILNVM 31 >1ih7_A DNA polymerase, GP43; fingers, PALM, thumb, transferase; HET: DNA GMP; 2.21A {Enterobacteria phage RB69} (A:385-426,A:576-732) Length = 199 Score = 25.4 bits (55), Expect = 9.7 Identities = 5/56 (8%), Positives = 17/56 (30%) Query: 100 LKDWIFVLPITTVVTSLMISHVDKSFLNKAFAIFCLLMGILMLKRDRLYCERKFPD 155 ++ +T++ S++ + + A G + L+ + Sbjct: 19 RYKYVMSFDLTSLYPSIIRQVNISRYYDLRNATAITTFGQMALQWIERKVNEYLNE 74 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.331 0.145 0.444 Gapped Lambda K H 0.267 0.0575 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,071,159 Number of extensions: 87676 Number of successful extensions: 307 Number of sequences better than 10.0: 1 Number of HSP's gapped: 306 Number of HSP's successfully gapped: 39 Length of query: 279 Length of database: 4,956,049 Length adjustment: 87 Effective length of query: 192 Effective length of database: 2,015,014 Effective search space: 386882688 Effective search space used: 386882688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 54 (24.9 bits)