BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780994|ref|YP_003065407.1| hypothetical protein CLIBASIA_04475 [Candidatus Liberibacter asiaticus str. psy62] (53 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780994|ref|YP_003065407.1| hypothetical protein CLIBASIA_04475 [Candidatus Liberibacter asiaticus str. psy62] Length = 53 Score = 110 bits (274), Expect = 5e-27, Method: Compositional matrix adjust. Identities = 53/53 (100%), Positives = 53/53 (100%) Query: 1 MNGDIFLVHRRDEMDSKNFSKAIEVRYTRLLEDNPILIGMGEGILFCGIFYAL 53 MNGDIFLVHRRDEMDSKNFSKAIEVRYTRLLEDNPILIGMGEGILFCGIFYAL Sbjct: 1 MNGDIFLVHRRDEMDSKNFSKAIEVRYTRLLEDNPILIGMGEGILFCGIFYAL 53 >gi|254780205|ref|YP_003064618.1| prenyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 310 Score = 23.5 bits (49), Expect = 0.63, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 25 VRYTRLLEDNPILIGMGEGILFCGIFY 51 + + LL+ NP +I +G +LF + Y Sbjct: 124 ISFVLLLQFNPFVICVGFALLFISLLY 150 >gi|254780532|ref|YP_003064945.1| aminodeoxychorismate lyase [Candidatus Liberibacter asiaticus str. psy62] Length = 325 Score = 23.1 bits (48), Expect = 0.86, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query: 14 MDSKNFSKAIEVR-YTRLLEDNPILIG 39 M S +F + V+ R L+DNP+L+G Sbjct: 105 MHSISFPEGFTVKQMARRLKDNPLLVG 131 >gi|254780943|ref|YP_003065356.1| glucosamine--fructose-6-phosphate aminotransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 608 Score = 23.1 bits (48), Expect = 1.0, Method: Composition-based stats. Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 35 PILIGMGEGILFCG 48 P++IG GEG +F G Sbjct: 177 PLIIGHGEGEMFVG 190 >gi|254780690|ref|YP_003065103.1| flagellar biosynthesis protein FlhB [Candidatus Liberibacter asiaticus str. psy62] Length = 354 Score = 22.3 bits (46), Expect = 1.5, Method: Composition-based stats. Identities = 7/24 (29%), Positives = 15/24 (62%) Query: 22 AIEVRYTRLLEDNPILIGMGEGIL 45 A+ +RY + D P+L+ G+ ++ Sbjct: 276 ALALRYIQTENDAPVLVAKGQNLI 299 >gi|255764476|ref|YP_003065238.2| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 792 Score = 20.8 bits (42), Expect = 5.2, Method: Composition-based stats. Identities = 7/13 (53%), Positives = 10/13 (76%) Query: 38 IGMGEGILFCGIF 50 IG+G+GI C +F Sbjct: 8 IGIGKGIEICTLF 20 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.329 0.149 0.445 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,568 Number of Sequences: 1233 Number of extensions: 1198 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 53 length of database: 328,796 effective HSP length: 25 effective length of query: 28 effective length of database: 297,971 effective search space: 8343188 effective search space used: 8343188 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 31 (16.5 bits)