RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780995|ref|YP_003065408.1| Endonuclease/exonuclease/phosphatase [Candidatus Liberibacter asiaticus str. psy62] (125 letters) >gnl|CDD|140318 PTZ00297, PTZ00297, pantothenate kinase; Provisional. Length = 1452 Score = 28.7 bits (64), Expect = 0.37 Identities = 13/16 (81%), Positives = 13/16 (81%), Gaps = 2/16 (12%) Query: 21 IPFVIAGDFNRKINSI 36 IPFVIAGDFN IN I Sbjct: 196 IPFVIAGDFN--INGI 209 >gnl|CDD|185163 PRK15251, PRK15251, cytolethal distending toxin subunit CdtB; Provisional. Length = 271 Score = 27.3 bits (61), Expect = 1.2 Identities = 26/96 (27%), Positives = 40/96 (41%), Gaps = 18/96 (18%) Query: 21 IPFVIAGDFNRKINSIGDTDDFWQKMDPDGL--LIRFPQEKESTCNVIKRNKSSLDYFVI 78 I ++IAGDFNR + + T +D + L + E T +R+ +LDY V Sbjct: 185 INWMIAGDFNRSPDRLEST------LDTEHLRNRVNIVAPTEPT----QRSGGTLDYAVT 234 Query: 79 DRDNKNFLIDNSFSIVSYDQSDLDTRRSKL-STHCP 113 N+ F + + RS+L S H P Sbjct: 235 GNSNQTFGPPLLAASLMLAS-----LRSQLASDHFP 265 >gnl|CDD|177627 PHA03391, p47, viral transcription regulator p47; Provisional. Length = 395 Score = 26.7 bits (60), Expect = 1.5 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 6/36 (16%) Query: 65 VIKRNKSSLDYFV--IDRDN----KNFLIDNSFSIV 94 +IKR+K S Y V +D +N K L D F+++ Sbjct: 197 IIKRHKFSKKYIVLELDANNWTAIKELLQDEFFTVI 232 >gnl|CDD|162892 TIGR02504, NrdJ_Z, ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent. This model identifies genes in a wide range of deeply branching bacteria. All are structurally related to the class I (non-heme iron dependent) RNRs. In most species this gene is known as NrdJ, while in mycobacteria it is called NrdZ. Length = 586 Score = 26.5 bits (59), Expect = 1.9 Identities = 12/52 (23%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Query: 29 FNRKINSIGDTDDFWQKMDPDGLL-IRFPQEKESTCNVIKRNKSSLDYFVID 79 FN S+G TD F + ++ D +R P+ E + + + + Y + Sbjct: 183 FN---ISVGVTDAFMEAVEADEEYKLRNPRTGEEIEELAELDPKNKVYKEVP 231 >gnl|CDD|152552 pfam12117, DUF3580, Protein of unknown function (DUF3580). This domain is found in viruses, and is about 120 amino acids in length. It is found in association with pfam01057. Length = 120 Score = 24.9 bits (54), Expect = 5.5 Identities = 10/35 (28%), Positives = 14/35 (40%), Gaps = 12/35 (34%) Query: 7 EWLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDD 41 +W + WA+ KI+T INS G Sbjct: 8 DWSENWAEPKIQTP------------INSPGSARS 30 >gnl|CDD|131789 TIGR02742, TrbC_Ftype, type-F conjugative transfer system pilin assembly protein TrbC. This protein is an essential component of the F-type conjugative pilus assembly system for the transfer of plasmid DNA. The N-terminal portion of these proteins are heterogeneous and are not covered by this model. Length = 130 Score = 24.7 bits (54), Expect = 6.2 Identities = 11/32 (34%), Positives = 12/32 (37%), Gaps = 4/32 (12%) Query: 9 LKKWADQKIKTGIPFVIAG----DFNRKINSI 36 LK+ DQ G P VI G F I Sbjct: 14 LKQLLDQAEALGAPLVIRGLLDNGFKATATRI 45 >gnl|CDD|117424 pfam08857, ParBc_2, Putative ParB-like nuclease. This domain is probably distantly related to pfam02195. Suggesting these uncharacterized proteins have a nuclease function. Length = 162 Score = 24.5 bits (54), Expect = 6.6 Identities = 12/45 (26%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Query: 8 WLKKWADQKIKTGIPFVIAGDFNRKINSIGDTDDFWQKMDPDGLL 52 L+ + + +P + D S D D FW KMD +G + Sbjct: 64 LLRALLELGVGGTVPVTVVADL-----SDLDKDAFWNKMDNNGWV 103 >gnl|CDD|183921 PRK13255, PRK13255, thiopurine S-methyltransferase; Reviewed. Length = 218 Score = 24.8 bits (55), Expect = 6.6 Identities = 5/14 (35%), Positives = 8/14 (57%) Query: 4 QQGEWLKKWADQKI 17 W +KWA+ +I Sbjct: 2 DPDFWHEKWAENQI 15 >gnl|CDD|180231 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed. Length = 912 Score = 24.7 bits (55), Expect = 6.7 Identities = 4/11 (36%), Positives = 7/11 (63%) Query: 7 EWLKKWADQKI 17 E LK+W + + Sbjct: 27 EILKRWEENDL 37 >gnl|CDD|178689 PLN03144, PLN03144, Carbon catabolite repressor protein 4 homolog; Provisional. Length = 606 Score = 24.7 bits (54), Expect = 7.3 Identities = 6/10 (60%), Positives = 8/10 (80%) Query: 21 IPFVIAGDFN 30 IP ++ GDFN Sbjct: 456 IPMLVCGDFN 465 >gnl|CDD|162079 TIGR00871, zwf, glucose-6-phosphate 1-dehydrogenase. This is a well-studied enzyme family, with sequences available from well over 50 species. The trusted cutoff is set above the score for the Drosophila melanogaster CG7140 gene product, a homolog of unknown function. G6PD homologs from the bacteria Aquifex aeolicus and Helicobacter pylori lack several motifs well conserved most other members, were omitted from the seed alignment, and score well below the trusted cutoff. Length = 482 Score = 24.6 bits (54), Expect = 7.8 Identities = 9/45 (20%), Positives = 15/45 (33%), Gaps = 6/45 (13%) Query: 83 KNFLIDNSFSIVSYDQSDLDT------RRSKLSTHCPLTIEYDFE 121 +N L+ F IV + DL R + I+ + Sbjct: 28 RNGLLPPDFRIVGVARRDLSVEDFRKQVREAIIKFETEEIDEQLD 72 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.137 0.416 Gapped Lambda K H 0.267 0.0690 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,035,932 Number of extensions: 115178 Number of successful extensions: 235 Number of sequences better than 10.0: 1 Number of HSP's gapped: 234 Number of HSP's successfully gapped: 25 Length of query: 125 Length of database: 5,994,473 Length adjustment: 82 Effective length of query: 43 Effective length of database: 4,222,617 Effective search space: 181572531 Effective search space used: 181572531 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.5 bits)