RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780996|ref|YP_003065409.1| hypothetical protein CLIBASIA_04485 [Candidatus Liberibacter asiaticus str. psy62] (109 letters) >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 31.9 bits (71), Expect = 0.033 Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 6/33 (18%) Query: 50 AIRKDVARVLQVSYPLPAPQEITPRMGNRKTVE 82 A++K LQ S L A + P + + T+E Sbjct: 21 ALKK-----LQASLKLYA-DDSAPALAIKATME 47 >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Score = 25.9 bits (57), Expect = 2.0 Identities = 9/50 (18%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Query: 11 SGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQ 60 SG GK + + G + G++ + +++V V Q Sbjct: 50 SGSGKTTILRLIAGLERPTK-----GDVWIGGKRVTDLPPQKRNVGLVFQ 94 >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Score = 25.9 bits (57), Expect = 2.4 Identities = 13/50 (26%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Query: 11 SGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQ 60 +G GK + + G S G I D D+ + D+A V Q Sbjct: 35 TGAGKTLFLELIAGFHVPDS-----GRILLDGKDVTDLSPEKHDIAFVYQ 79 >2awn_A Maltose/maltodextrin import ATP-binding protein MALK; ATP-binding cassette, transport protein; HET: ADP; 2.30A {Escherichia coli K12} SCOP: b.40.6.3 c.37.1.12 PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 2r6g_A* 1q1b_A Length = 381 Score = 25.6 bits (56), Expect = 2.5 Identities = 13/50 (26%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Query: 11 SGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQ 60 SGCGK+ + + G +S G++ E +N + V V Q Sbjct: 38 SGCGKSTLLRMIAGLETITS-----GDLFIGEKRMNDTPPAERGVGMVFQ 82 >3akh_A Putative secreted alpha L-arabinofuranosidase II; five-bladed beta propeller, beta-trefoil, hydrolase; HET: AHR; 1.70A {Streptomyces avermitilis} PDB: 3akf_A* 3akg_A* 3aki_A* Length = 468 Score = 25.8 bits (56), Expect = 2.6 Identities = 7/35 (20%), Positives = 17/35 (48%) Query: 3 EDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGN 37 + KWY++++ + VW L + + +G+ Sbjct: 85 DGKWYVYFAAGSTSDVWAIRMYVLESGAANPLTGS 119 >3jyw_X 60S ribosomal protein L35; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Length = 86 Score = 25.0 bits (55), Expect = 4.7 Identities = 6/12 (50%), Positives = 8/12 (66%) Query: 50 AIRKDVARVLQV 61 +RK +A VL V Sbjct: 45 TVRKSIACVLTV 56 >3kwo_A Putative bacterioferritin; alpha-helix, bacterial ferritin fold, structural genomics, center for structural genomics of infectious diseases; 1.99A {Campylobacter jejuni} Length = 152 Score = 24.5 bits (53), Expect = 6.2 Identities = 5/27 (18%), Positives = 12/27 (44%), Gaps = 3/27 (11%) Query: 80 TVELLIEID---DQKVWLLNVHLKSSC 103 T E ++ +W++ L+ +C Sbjct: 124 TAAFAQENIAKYEKSLWMIGATLQGAC 150 >2fb5_A Hypothetical membrane spanning protein; structural genomics, membrane protein, PSI, protein structure initiative; 1.99A {Bacillus cereus} SCOP: d.320.1.1 Length = 205 Score = 24.4 bits (53), Expect = 6.5 Identities = 7/31 (22%), Positives = 13/31 (41%) Query: 48 AIAIRKDVARVLQVSYPLPAPQEITPRMGNR 78 A+ ++ + PL E+ P +G R Sbjct: 137 AVLVKNNHIVSAANILPLTKSTEVDPELGTR 167 >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Score = 24.5 bits (53), Expect = 6.7 Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 5/56 (8%) Query: 11 SGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLP 66 SG GK+ + ++ G +S G I DE D+ ++V V Q P Sbjct: 38 SGSGKSTLLYTIAGIYKPTS-----GKIYFDEKDVTELPPKDRNVGLVFQNWALYP 88 >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Score = 24.4 bits (53), Expect = 6.9 Identities = 12/56 (21%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Query: 11 SGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLP 66 SGCGK + G + G I + D+ ++++ V Q P Sbjct: 46 SGCGKTTTLRMIAGLEEPTE-----GRIYFGDRDVTYLPPKDRNISMVFQSYAVWP 96 >3c1y_A DNA integrity scanning protein DISA; DNA damage, DNA repair, DNA-binding, DNA binding protein; HET: DNA 2BA; 2.10A {Thermotoga maritima} PDB: 3c1z_A* 3c21_A* 3c23_A* Length = 377 Score = 23.9 bits (52), Expect = 8.1 Identities = 8/32 (25%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Query: 48 AIAIRKDVARVLQVSYPLPAPQEI-TPRMGNR 78 AI + +D+ ++ + L I T G R Sbjct: 97 AIVLSEDITKIYYANVHLVPDPTIPTGETGTR 128 >2c1l_A Restriction endonuclease; BFII, domain fusion, hydrolase; HET: TAR TLA SRT MES; 1.9A {Bacillus firmus} Length = 358 Score = 24.2 bits (52), Expect = 8.4 Identities = 15/62 (24%), Positives = 25/62 (40%), Gaps = 12/62 (19%) Query: 1 MPEDKWYIFYSGCG--KNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAI--RKDVA 56 M W+I +P W+ + YD+ + N+ DE++ T I D A Sbjct: 160 MLNQNWHIHNMTNATDASPGWNLL--------YDERTTNLTLDETERVTLIVTLGHADTA 211 Query: 57 RV 58 R+ Sbjct: 212 RI 213 >2pyb_A NAPA, neutrophil activating protein; ferritin, DPS, four-helix bundle, metal transport; 2.60A {Borrelia burgdorferi} Length = 151 Score = 23.8 bits (51), Expect = 8.8 Identities = 7/85 (8%), Positives = 29/85 (34%), Gaps = 8/85 (9%) Query: 21 SMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNRKT 80 + S + ++ ++ V + ++ + +++ G+ T Sbjct: 71 RYSEFMKKSFIKELDIESTSNFLP-----SMESIVCSLTEILKNIFGMRKLIDTAGDYGT 125 Query: 81 VELLIEIDD---QKVWLLNVHLKSS 102 ++ +I + +W+ L++ Sbjct: 126 ANIMDDIMSDLEKHLWMHKALLENC 150 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.317 0.135 0.417 Gapped Lambda K H 0.267 0.0609 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 967,930 Number of extensions: 38390 Number of successful extensions: 153 Number of sequences better than 10.0: 1 Number of HSP's gapped: 153 Number of HSP's successfully gapped: 21 Length of query: 109 Length of database: 5,693,230 Length adjustment: 73 Effective length of query: 36 Effective length of database: 3,923,418 Effective search space: 141243048 Effective search space used: 141243048 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.3 bits)