RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780996|ref|YP_003065409.1| hypothetical protein CLIBASIA_04485 [Candidatus Liberibacter asiaticus str. psy62] (109 letters) >d1m3ya2 b.121.2.3 (A:222-437) Major capsid protein vp54 {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]} Length = 216 Score = 25.0 bits (53), Expect = 1.7 Identities = 9/47 (19%), Positives = 14/47 (29%), Gaps = 1/47 (2%) Query: 1 MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINT 47 YS K G NFS D+ + ++ I+ Sbjct: 124 GVTPAGVYLYSFALKPAGRQPS-GTCNFSRIDNATLSLTYKTCSIDA 169 >g1f8v.1 b.121.4.4 (A:,D:) Alphanodavirus capsid protein {Pariacoto virus [TaxId: 103782]} Length = 395 Score = 24.2 bits (52), Expect = 2.8 Identities = 8/28 (28%), Positives = 11/28 (39%) Query: 52 RKDVARVLQVSYPLPAPQEITPRMGNRK 79 RK V+R + PA Q P + Sbjct: 7 RKVVSRSTALVPMAPASQRTGPAPRKPR 34 >d1ys5a1 f.4.1.3 (A:2-156) Lipoprotein GNA1870 immunodominant domain {Neisseria meningitidis [TaxId: 487]} Length = 155 Score = 24.1 bits (52), Expect = 3.6 Identities = 5/31 (16%), Positives = 10/31 (32%) Query: 19 WDSMKGCLNFSSYDDNSGNIDTDESDINTAI 49 + + +G N+D +DI Sbjct: 72 FAAKQGNGKIEHLKSPELNVDLAAADIKPDG 102 >d2fjca1 a.25.1.1 (A:27-177) Dodecameric ferritin homolog {Treponema pallidum, TpF1 [TaxId: 160]} Length = 151 Score = 23.2 bits (49), Expect = 6.6 Identities = 11/85 (12%), Positives = 26/85 (30%), Gaps = 3/85 (3%) Query: 17 PVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMG 76 SM L S + + T S + +++D + + Sbjct: 70 QAPASMAEYLALSGIAEETEKEITIVSAL---ARVKRDFEYLSTRFSQTQVLAAESGDAV 126 Query: 77 NRKTVELLIEIDDQKVWLLNVHLKS 101 + ++ + +W+L LK+ Sbjct: 127 TDGIITDILRTLGKAIWMLGATLKA 151 >d2fb5a1 d.320.1.1 (A:5-205) Hypothetical protein BC4920 (YojJ) {Bacillus cereus [TaxId: 1396]} Length = 201 Score = 22.9 bits (49), Expect = 8.0 Identities = 7/31 (22%), Positives = 13/31 (41%) Query: 48 AIAIRKDVARVLQVSYPLPAPQEITPRMGNR 78 A+ ++ + PL E+ P +G R Sbjct: 133 AVLVKNNHIVSAANILPLTKSTEVDPELGTR 163 >d1vpsa_ b.121.6.1 (A:) Polyomavirus coat proteins {Murine polyomavirus, strain small-plaque 16 [TaxId: 10634]} Length = 285 Score = 22.9 bits (49), Expect = 8.3 Identities = 11/32 (34%), Positives = 15/32 (46%) Query: 71 ITPRMGNRKTVELLIEIDDQKVWLLNVHLKSS 102 + PRMG T E L E W ++L +S Sbjct: 22 LNPRMGQPPTPESLTEGGQYYGWSRGINLATS 53 >d1ltka_ c.86.1.1 (A:) Phosphoglycerate kinase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 417 Score = 22.7 bits (48), Expect = 9.6 Identities = 8/30 (26%), Positives = 18/30 (60%), Gaps = 3/30 (10%) Query: 74 RMGNRKTVELLIEIDDQKVWL---LNVHLK 100 +GN+ ++ L +I ++KV + NV ++ Sbjct: 3 HLGNKLSISDLKDIKNKKVLVRVDFNVPIE 32 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.317 0.135 0.417 Gapped Lambda K H 0.267 0.0551 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 422,749 Number of extensions: 16942 Number of successful extensions: 57 Number of sequences better than 10.0: 1 Number of HSP's gapped: 57 Number of HSP's successfully gapped: 15 Length of query: 109 Length of database: 2,407,596 Length adjustment: 68 Effective length of query: 41 Effective length of database: 1,473,956 Effective search space: 60432196 Effective search space used: 60432196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.3 bits)