Query gi|254780997|ref|YP_003065410.1| hypothetical protein CLIBASIA_04490 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 78 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 04:38:50 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780997.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR01849 PHB_depoly_PhaZ poly 71.5 1.8 4.7E-05 23.1 1.2 24 16-42 113-136 (414) 2 pfam08552 Kei1 Inositolphospho 71.1 7.5 0.00019 19.8 4.2 54 6-64 10-63 (178) 3 TIGR00847 ccoS cytochrome oxid 58.6 11 0.00029 18.8 3.1 23 45-67 2-24 (53) 4 pfam05437 AzlD Branched-chain 43.8 29 0.00073 16.6 3.9 39 22-60 10-48 (96) 5 TIGR01417 PTS_I_fam phosphoeno 40.4 16 0.0004 18.0 1.5 17 17-33 360-376 (576) 6 PRK04949 putative sulfate tran 33.6 42 0.0011 15.7 6.2 55 11-66 91-160 (251) 7 COG1080 PtsA Phosphoenolpyruva 32.6 22 0.00057 17.2 1.3 26 9-34 341-368 (574) 8 TIGR01955 RfaH transcriptional 26.5 28 0.00072 16.6 1.0 12 8-19 139-150 (162) 9 COG2981 CysZ Uncharacterized p 24.6 61 0.0016 14.8 5.9 15 14-28 92-106 (250) 10 KOG2290 consensus 23.3 65 0.0017 14.6 4.2 45 24-71 524-568 (652) 11 PRK04940 hypothetical protein; 22.0 32 0.00082 16.3 0.5 34 16-49 64-101 (179) 12 COG3197 FixS Uncharacterized p 21.9 62 0.0016 14.7 2.0 21 46-66 3-23 (58) 13 PTZ00224 protein phosphatase 2 20.7 55 0.0014 15.0 1.5 30 20-49 312-344 (381) No 1 >TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular; InterPro: IPR010915 This entry represents an intracellular depolymerase for polyhydroxyalkanoate (PHA), a carbon and energy storing polyester that accumulates in granules in many bacterial species when carbon sources are abundant but other nutrients are limiting.. Probab=71.53 E-value=1.8 Score=23.12 Aligned_cols=24 Identities=58% Similarity=0.884 Sum_probs=21.7 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHCCCC Q ss_conf 645801448999999999753420873 Q gi|254780997|r 16 LIGNPFSGFYAIRFSLLRSVDQSLLPP 42 (78) Q Consensus 16 lignpfsgfyairfsllrsvdqsllpp 42 (78) ||=-|.||.|| .||||.=.+|||- T Consensus 113 LiVAPmSGHyA---TLLR~TV~aLLP~ 136 (414) T TIGR01849 113 LIVAPMSGHYA---TLLRSTVEALLPD 136 (414) T ss_pred EEECCCHHHHH---HHHHHHHHHHCCC T ss_conf 78567412566---6556789985789 No 2 >pfam08552 Kei1 Inositolphosphorylceramide synthase subunit Kei1. Kei1 is a subunit of Saccharomyces cerevisiae inositol phosphorylceramide (IPC) synthase. It is localized to the Golgi and is cleaved by the late Golgi processing endopeptidase Kex2. Kei1 is essential for both the activity and the Golgi localization of IPC synthase. Probab=71.13 E-value=7.5 Score=19.78 Aligned_cols=54 Identities=37% Similarity=0.603 Sum_probs=41.0 Q ss_pred HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 44456789876458014489999999997534208738999999999999999998889 Q gi|254780997|r 6 LIDRSVVLLNLIGNPFSGFYAIRFSLLRSVDQSLLPPWQQFLFYLLPVAVLVPFISFFP 64 (78) Q Consensus 6 lidrsvvllnlignpfsgfyairfsllrsvdqsllppwqqflfyllpvavlvpfisffp 64 (78) -+.-+++++-+|=|..||.|.+- +++.. .-+-+| |..+|+.-+++|+.+..-+| T Consensus 10 ~tG~elI~l~~i~NK~sG~YGlL-AlfTG---~~lsf~-Q~smYlySi~~L~~~a~~l~ 63 (178) T pfam08552 10 YIGVELILLSAIFNKASGLYGIL-ALFTG---HPLSFW-QWLMYLYSVLTLIVYASGLP 63 (178) T ss_pred HHHHHHHHHHHHHHHHHHHHHHH-HHHHC---CCCCHH-HHHHHHHHHHHHHHHHHHCC T ss_conf 98499999999999874799999-99957---999899-99999999999999997641 No 3 >TIGR00847 ccoS cytochrome oxidase maturation protein, cbb3-type; InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation . Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase. . Probab=58.56 E-value=11 Score=18.80 Aligned_cols=23 Identities=26% Similarity=0.556 Sum_probs=18.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999998889999 Q gi|254780997|r 45 QFLFYLLPVAVLVPFISFFPFLI 67 (78) Q Consensus 45 qflfyllpvavlvpfisffpfli 67 (78) ..|+||+||+++.-++...-|+= T Consensus 2 ~~L~~L~Pisl~lG~~GL~AFlW 24 (53) T TIGR00847 2 EILTILIPISLLLGGVGLVAFLW 24 (53) T ss_pred CHHHHHHHHHHHHHHHHHHHHHH T ss_conf 52577889999999999999998 No 4 >pfam05437 AzlD Branched-chain amino acid transport protein (AzlD). This family consists of a number of bacterial and archaeal branched-chain amino acid transport proteins. AzlD is known to be involved in conferring resistance to 4-azaleucine although its exact role is uncertain. Probab=43.76 E-value=29 Score=16.58 Aligned_cols=39 Identities=36% Similarity=0.428 Sum_probs=32.5 Q ss_pred HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH Q ss_conf 448999999999753420873899999999999999999 Q gi|254780997|r 22 SGFYAIRFSLLRSVDQSLLPPWQQFLFYLLPVAVLVPFI 60 (78) Q Consensus 22 sgfyairfsllrsvdqsllppwqqflfyllpvavlvpfi 60 (78) -+-|..|++-+......-+|||-+...-.+|+|++..-+ T Consensus 10 ~~T~l~R~~p~~~~~~~~~p~~~~~~l~~vP~avl~aLi 48 (96) T pfam05437 10 LVTYLTRYLPLLLFSRLPLPPRVQRLLRYVPVAVLAALI 48 (96) T ss_pred HHHHHHHHHHHHHCCCCCCCHHHHHHHHHCHHHHHHHHH T ss_conf 999999999998647888998999998136899999999 No 5 >TIGR01417 PTS_I_fam phosphoenolpyruvate-protein phosphotransferase; InterPro: IPR006318 These sequences are a distinct clade of phophoenolpyruvate (PEP)-dependent enzymes. Most members are known or deduced to function as the phosphoenolpyruvate-protein phosphotransferase (or enzyme I) of PTS sugar transport systems. However, some species with both a member of this family and a homolog of the phosphocarrier protein HPr lack a IIC component able to serve as a permease. An HPr homolog designated NPr has been implicated in the regulation of nitrogen assimilation, which demonstrates that not all phosphotransferase system components are associated directly with PTS transport. ; GO: 0016772 transferase activity transferring phosphorus-containing groups. Probab=40.42 E-value=16 Score=18.01 Aligned_cols=17 Identities=47% Similarity=0.737 Sum_probs=13.8 Q ss_pred HCCCHHHHHHHHHHHHH Q ss_conf 45801448999999999 Q gi|254780997|r 17 IGNPFSGFYAIRFSLLR 33 (78) Q Consensus 17 ignpfsgfyairfsllr 33 (78) =-|||-||-|||..+=+ T Consensus 360 E~NPFLG~RAiR~~le~ 376 (576) T TIGR01417 360 EENPFLGYRAIRLLLEK 376 (576) T ss_pred CCCCCHHHHHHHHHHHH T ss_conf 88774379999998759 No 6 >PRK04949 putative sulfate transport protein CysZ; Validated Probab=33.57 E-value=42 Score=15.66 Aligned_cols=55 Identities=36% Similarity=0.630 Sum_probs=32.8 Q ss_pred HHHHHHHCCCHHHHHHHHHHHHH---------------HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 78987645801448999999999---------------753420873899999999999999999888999 Q gi|254780997|r 11 VVLLNLIGNPFSGFYAIRFSLLR---------------SVDQSLLPPWQQFLFYLLPVAVLVPFISFFPFL 66 (78) Q Consensus 11 vvllnlignpfsgfyairfsllr---------------svdqsllppwqqflfyllpvavlvpfisffpfl 66 (78) .++-|+||.||.|.-|-|-.-.. .+-.++.-.|+ .+.|.+|.++..=.+||.|.. T Consensus 91 t~i~~li~aPF~g~LaEkvE~~ltG~~~~~~~~~~l~~~i~r~l~~elr-kl~y~l~~~i~lllL~fIPvv 160 (251) T PRK04949 91 STLANWIAAPFNGLLAEKVEALLTGETLPDTGIAGLVKDVPRILKREWQ-KLAYYLPRAIVLLLLSFIPVV 160 (251) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999727769999999998559999985488999999999999999-999999999999999999860 No 7 >COG1080 PtsA Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism] Probab=32.58 E-value=22 Score=17.19 Aligned_cols=26 Identities=50% Similarity=0.760 Sum_probs=18.0 Q ss_pred HHHHHHHHH--CCCHHHHHHHHHHHHHH Q ss_conf 567898764--58014489999999997 Q gi|254780997|r 9 RSVVLLNLI--GNPFSGFYAIRFSLLRS 34 (78) Q Consensus 9 rsvvllnli--gnpfsgfyairfsllrs 34 (78) ..+-.+|+- .|||-|+-+||.++-|. T Consensus 341 K~lpyl~lp~E~NPfLG~RaIRl~l~~~ 368 (574) T COG1080 341 KPLPYLNLPKEENPFLGYRAIRLSLERP 368 (574) T ss_pred CCCCCCCCCCCCCCHHHHHHHHHHHCCH T ss_conf 8699898864337213368999853209 No 8 >TIGR01955 RfaH transcriptional activator RfaH; InterPro: IPR010215 This entry represents the transcriptional activator protein, RfaH . This protein is most closely related to the transcriptional termination/antitermination protein NusG (IPR001062 from INTERPRO) and contains the KOW motif (IPR005824 from INTERPRO) . This protein appears to be limited to the proteobacteria. In Escherichia coli, this gene appears to control the expression of haemolysin, sex factor and lipopolysaccharide genes.; GO: 0003711 transcription elongation regulator activity, 0006355 regulation of transcription DNA-dependent. Probab=26.55 E-value=28 Score=16.61 Aligned_cols=12 Identities=67% Similarity=1.071 Sum_probs=10.2 Q ss_pred HHHHHHHHHHCC Q ss_conf 456789876458 Q gi|254780997|r 8 DRSVVLLNLIGN 19 (78) Q Consensus 8 drsvvllnlign 19 (78) .||++|||+||. T Consensus 139 ~R~~~Llnm~~~ 150 (162) T TIGR01955 139 KRSVLLLNMIGK 150 (162) T ss_pred HHHHHHHHHHCC T ss_conf 477665466365 No 9 >COG2981 CysZ Uncharacterized protein involved in cysteine biosynthesis [Amino acid transport and metabolism] Probab=24.61 E-value=61 Score=14.77 Aligned_cols=15 Identities=47% Similarity=0.828 Sum_probs=9.0 Q ss_pred HHHHCCCHHHHHHHH Q ss_conf 876458014489999 Q gi|254780997|r 14 LNLIGNPFSGFYAIR 28 (78) Q Consensus 14 lnlignpfsgfyair 28 (78) -|+|+.||.|.-|-. T Consensus 92 ~~~IAapFng~lAEk 106 (250) T COG2981 92 ANLIAAPFNGLLAEK 106 (250) T ss_pred HHHHHHHHHHHHHHH T ss_conf 999971452689999 No 10 >KOG2290 consensus Probab=23.30 E-value=65 Score=14.63 Aligned_cols=45 Identities=36% Similarity=0.524 Sum_probs=26.9 Q ss_pred HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 899999999975342087389999999999999999988899999997 Q gi|254780997|r 24 FYAIRFSLLRSVDQSLLPPWQQFLFYLLPVAVLVPFISFFPFLIDAFA 71 (78) Q Consensus 24 fyairfsllrsvdqsllppwqqflfyllpvavlvpfisffpflidafa 71 (78) ..|--|--|-.--|-|-+||+.|. -|-+.+||-||.+.|. ||.+| T Consensus 524 ila~l~vEl~qs~~il~~~w~a~~--~Lia~~L~L~iGliPW-iDN~a 568 (652) T KOG2290 524 ILACLFVELFQSWQILERPWRAFF--HLIATLLVLCIGLIPW-IDNWA 568 (652) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHCCCCC-HHHHH T ss_conf 399999999863675314799999--9999999998424310-11188 No 11 >PRK04940 hypothetical protein; Provisional Probab=21.97 E-value=32 Score=16.31 Aligned_cols=34 Identities=24% Similarity=0.368 Sum_probs=25.5 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHC----CCCHHHHHHH Q ss_conf 645801448999999999753420----8738999999 Q gi|254780997|r 16 LIGNPFSGFYAIRFSLLRSVDQSL----LPPWQQFLFY 49 (78) Q Consensus 16 lignpfsgfyairfsllrsvdqsl----lppwqqflfy 49 (78) +||--..||||.|++-+-...+-| +.|+..+--| T Consensus 64 iiGssLGGyyA~~l~~~~~~KaVliNPal~P~~~m~~~ 101 (179) T PRK04940 64 ICGVGLGGYWAERIGFLCGIRQVIFNPNLFPEENMEGK 101 (179) T ss_pred EEECCCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHH T ss_conf 99547238999999998298679988998804655655 No 12 >COG3197 FixS Uncharacterized protein, possibly involved in nitrogen fixation [Inorganic ion transport and metabolism] Probab=21.92 E-value=62 Score=14.73 Aligned_cols=21 Identities=33% Similarity=0.713 Sum_probs=16.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999888999 Q gi|254780997|r 46 FLFYLLPVAVLVPFISFFPFL 66 (78) Q Consensus 46 flfyllpvavlvpfisffpfl 66 (78) -+++|.||+++.-++...-|+ T Consensus 3 ~l~~Lipvsi~l~~v~l~~fl 23 (58) T COG3197 3 ILYILIPVSILLGAVGLGAFL 23 (58) T ss_pred EEEEHHHHHHHHHHHHHHHHH T ss_conf 442179999999999999999 No 13 >PTZ00224 protein phosphatase 2C; Provisional Probab=20.65 E-value=55 Score=15.02 Aligned_cols=30 Identities=23% Similarity=0.350 Sum_probs=22.4 Q ss_pred CHHHHHHHHHHHHHHHHHHCC---CCHHHHHHH Q ss_conf 014489999999997534208---738999999 Q gi|254780997|r 20 PFSGFYAIRFSLLRSVDQSLL---PPWQQFLFY 49 (78) Q Consensus 20 pfsgfyairfsllrsvdqsll---ppwqqflfy 49 (78) .-..-..-|+.+|++.+...+ +||+||-|- T Consensus 312 t~~~~l~~ry~~l~~~~~~~~~~~~~~~~~~~~ 344 (381) T PTZ00224 312 TTAAALEKRYDLLKAFEKKTLNEQEPVMQTAFE 344 (381) T ss_pred CHHHHHHHHHHHHHHHHHCCCCCCCHHHHHCCC T ss_conf 699999999999998764474436725653459 Done!