RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780997|ref|YP_003065410.1| hypothetical protein CLIBASIA_04490 [Candidatus Liberibacter asiaticus str. psy62] (78 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 40.3 bits (94), Expect = 1e-04 Identities = 27/98 (27%), Positives = 37/98 (37%), Gaps = 34/98 (34%) Query: 2 INQIL-IDR--SVVLLN------LIGNPFSGFYAIRFSL-LRSV------DQSLLPPWQ- 44 N L + + L+N + G P S Y +L LR DQS +P + Sbjct: 356 TNSHLPAGKQVEISLVNGAKNLVVSGPPQS-LYG--LNLTLRKAKAPSGLDQSRIPFSER 412 Query: 45 ------QFLFYLLPVAVLVPFISFFPFLIDAFALGLQD 76 +FL PVA PF S L+ A L +D Sbjct: 413 KLKFSNRFL----PVAS--PFHS--HLLVPASDLINKD 442 Score = 26.1 bits (57), Expect = 2.2 Identities = 17/85 (20%), Positives = 25/85 (29%), Gaps = 27/85 (31%) Query: 6 LIDRSV-VLLNLIGNP--FSGFYAIRFSLLRSVDQSLLPPWQQFLF---------YLLPV 53 LI S L LI + ++L W L YLL + Sbjct: 187 LIKFSAETLSELIRTTLDAEKVFTQGLNILE---------W---LENPSNTPDKDYLLSI 234 Query: 54 AVLVPFI---SFFPFLIDAFALGLQ 75 + P I +++ A LG Sbjct: 235 PISCPLIGVIQLAHYVVTAKLLGFT 259 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.335 0.152 0.475 Gapped Lambda K H 0.267 0.0498 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 683,297 Number of extensions: 25339 Number of successful extensions: 90 Number of sequences better than 10.0: 1 Number of HSP's gapped: 90 Number of HSP's successfully gapped: 9 Length of query: 78 Length of database: 5,693,230 Length adjustment: 47 Effective length of query: 31 Effective length of database: 4,553,762 Effective search space: 141166622 Effective search space used: 141166622 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 50 (23.6 bits)