RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780998|ref|YP_003065411.1| hypothetical protein CLIBASIA_04495 [Candidatus Liberibacter asiaticus str. psy62] (146 letters) >gnl|CDD|181767 PRK09296, PRK09296, cysteine desufuration protein SufE; Provisional. Length = 138 Score = 81.2 bits (201), Expect = 8e-17 Identities = 36/113 (31%), Positives = 62/113 (54%), Gaps = 4/113 (3%) Query: 19 DRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQI 78 ++Y Y+IELG++LP E + QN++ GC S++W+V+ +G I+ SD+ I Sbjct: 22 EKYLYIIELGQRLPPLTDEDRSPQNLIQGCQSQVWIVMRQNAQG----IIELQGDSDAAI 77 Query: 79 VCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKI 131 V GL+ +V +Y +I+ D + L LT++L+ R GL ++ I Sbjct: 78 VKGLIAVVFILYQQMTPQDIVNFDVRPWFEKLALTQHLTPSRSQGLEAMIRAI 130 >gnl|CDD|132432 TIGR03391, FeS_syn_CsdE, cysteine desulfurase, sulfur acceptor subunit CsdE. Members of this protein family are CsdE, formerly called YgdK. This protein, found as a paralog to SufE in Escherichia coli, Yersinia pestis, Photorhabdus luminescens, and related species, works together and physically interacts with CsdA (a paralog of SufS). CsdA has cysteine desulfurase activity that is enhanced by this protein (CsdE), in which Cys-61 (numbered as in E. coli) is a sulfur acceptor site. This gene pair, although involved in FeS cluster biosynthesis, is not found next to other such genes as are its paralogs from the Suf or Isc systems. Length = 138 Score = 78.7 bits (194), Expect = 5e-16 Identities = 43/134 (32%), Positives = 61/134 (45%), Gaps = 10/134 (7%) Query: 2 IPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENK 61 I D+I DRY LI L K+LP P+ T + GC +++W+ Sbjct: 10 ITAADLIATFAACRQWEDRYRQLILLAKQLPALPEALKTQATELTGCENRVWL------- 62 Query: 62 GDQ---DPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQ 118 G Q D + FY S+ +IV GLL ++ + K ++L D L + LGL LS Sbjct: 63 GHQVLPDGTLHFYGDSEGRIVRGLLAVLLTAVEGKTPEQLLAQDPLALFDELGLRAQLSA 122 Query: 119 KRMNGLYTIVNKIQ 132 R NGL + IQ Sbjct: 123 SRSNGLAALAAAIQ 136 >gnl|CDD|184980 PRK15019, PRK15019, CsdA-binding activator; Provisional. Length = 147 Score = 71.9 bits (176), Expect = 5e-14 Identities = 37/119 (31%), Positives = 56/119 (47%), Gaps = 4/119 (3%) Query: 19 DRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQI 78 D+Y LI LGK+LP P E +AGC +++W+ G M F+ S+ +I Sbjct: 32 DKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGK----MHFFGDSEGRI 87 Query: 79 VCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDLTQE 137 V GLL ++ + K +E+ L + LGL LS R GL + I T++ Sbjct: 88 VRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAATKQ 146 >gnl|CDD|178278 PLN02673, PLN02673, quinolinate synthetase A. Length = 724 Score = 46.9 bits (111), Expect = 2e-06 Identities = 37/133 (27%), Positives = 67/133 (50%), Gaps = 10/133 (7%) Query: 7 IIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDP 66 +I++ + + + DR L+ LP P+ + N V GC +++W+ E + DQD Sbjct: 88 LIKEFKSLTEPVDRVKRLLHYASLLPPLPESSRVESNRVMGCTAQVWL----EAELDQDG 143 Query: 67 IMIFYAVSDSQI---VCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNG 123 M F+A SDS+I C L V + +++ E LK + L L ++GL + R+N Sbjct: 144 KMRFWADSDSEITKGFCSCLIWVLDGASPEEVLE-LKTEDLAAL-NVGLPGG-ERSRVNT 200 Query: 124 LYTIVNKIQDLTQ 136 + ++ +Q T+ Sbjct: 201 WHNVLVSMQKRTR 213 >gnl|CDD|173345 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional. Length = 693 Score = 30.7 bits (69), Expect = 0.17 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 13/52 (25%) Query: 71 YAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMN 122 Y V++ Q++CG YI +YA K+ EI LT+NL +K +N Sbjct: 398 YDVTN-QLLCGSCYIASQMYAFKRRIEI------------ALTKNLDKKYLN 436 >gnl|CDD|132132 TIGR03088, stp2, sugar transferase, PEP-CTERM/EpsH1 system associated. Members of this family include a match to the pfam00534 Glycosyl transferases group 1 domain. Nearly all are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria. In particular, these transferases are found proximal to a particular variant of exosortase, EpsH1, which appears to travel with a conserved group of genes summarized by Genome Property GenProp0652. The nature of the sugar transferase reaction catalyzed by members of this clade is unknown and may conceivably be variable with respect to substrate by species, but we hypothesize a conserved substrate. Length = 374 Score = 28.9 bits (65), Expect = 0.56 Identities = 10/38 (26%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Query: 18 HDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMV 55 +R+H G + P+ P ++ D+++V G + +L V Sbjct: 171 TERFH--PSRGDRSPILPPDFFADESVVVGTVGRLQAV 206 >gnl|CDD|163340 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase. Members of this protein family are polyribonucleotide nucleotidyltransferase, also called polynucleotide phosphorylase. Some members have been shown also to have additional functions as guanosine pentaphosphate synthetase and as poly(A) polymerase (see model TIGR02696 for an exception clade, within this family). Length = 684 Score = 26.7 bits (60), Expect = 2.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 32 PLFPKEYMTDQNIVAGCMS 50 PLFPK + + +VA +S Sbjct: 92 PLFPKGFRNEVQVVATVLS 110 >gnl|CDD|128580 smart00284, OLF, Olfactomedin-like domains. Length = 255 Score = 26.3 bits (58), Expect = 3.3 Identities = 20/90 (22%), Positives = 42/90 (46%), Gaps = 18/90 (20%) Query: 18 HDRYHYLIELGKKLPLFPKE------YMTDQN---IVAGCMSKLWMVIE--WENKGDQDP 66 ++R+ Y + L E Y T+QN IV ++ + IE W ++ Sbjct: 118 NNRFPYAWGGFSDIDLAVDENGLWVIYATEQNAGKIVISKLNPATLTIENTWITTYNKR- 176 Query: 67 IMIFYAVSDSQIVCGLLYIVKSIYA-HKKI 95 + S++ ++CG+LY+ +S+ + +K+ Sbjct: 177 -----SASNAFMICGILYVTRSLGSKGEKV 201 >gnl|CDD|180485 PRK06245, cofG, FO synthase subunit 1; Reviewed. Length = 336 Score = 25.6 bits (57), Expect = 4.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 5 NDIIEDMEMIEDLHDRYHYLIE 26 D E +E I +LH+RY ++ E Sbjct: 182 EDRAESLEAIAELHERYGHIQE 203 >gnl|CDD|131451 TIGR02398, gluc_glyc_Psyn, glucosylglycerol-phosphate synthase. Glucosylglycerol-phosphate synthase catalyzes the key step in the biosynthesis of the osmolyte glucosylglycerol. It is known in several cyanobacteria and in Pseudomonas anguilliseptica. The enzyme is closely related to the alpha,alpha-trehalose-phosphate synthase, likewise involved in osmolyte biosynthesis, of E. coli and many other bacteria. A close homolog from Xanthomonas campestris is excluded from this model and scores between trusted and noise. Length = 487 Score = 25.6 bits (56), Expect = 4.9 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Query: 100 KMDSLTILQHLGLTENLSQKRMNGLYTIVNK--IQDLTQEYL 139 +MD TI L + + Q RM ++ VN +Q E+L Sbjct: 437 RMDE-TIYVALAMPKAEQQARMREMFDAVNYYDVQRWADEFL 477 >gnl|CDD|183327 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional. Length = 693 Score = 25.4 bits (57), Expect = 6.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 32 PLFPKEYMTDQNIVAGCMS 50 PLFPK + + +VA +S Sbjct: 101 PLFPKGFRNEVQVVATVLS 119 >gnl|CDD|183014 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed. Length = 588 Score = 25.2 bits (56), Expect = 7.2 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 15/48 (31%) Query: 11 MEMIEDLHDRY-HYL--IELGKKLPL------FPKEYMTDQNIVAGCM 49 +E +ED+HD Y YL + L +PL FP N AG + Sbjct: 127 LEQVEDMHDFYARYLPQMALAVLVPLLILIAVFP------INWAAGLI 168 >gnl|CDD|183385 PRK11929, PRK11929, putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D- alanine ligase; Provisional. Length = 958 Score = 25.0 bits (55), Expect = 8.2 Identities = 10/27 (37%), Positives = 17/27 (62%) Query: 116 LSQKRMNGLYTIVNKIQDLTQEYLNVH 142 L Q R++GL V +LT+++L+ H Sbjct: 192 LEQGRLDGLRIAVAGFTNLTRDHLDYH 218 >gnl|CDD|178007 PLN02381, PLN02381, valyl-tRNA synthetase. Length = 1066 Score = 24.5 bits (53), Expect = 9.8 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 9/60 (15%) Query: 29 KKLPLFPKEYMTD-----QNIVAGCMSK-LW---MVIEWENKGDQDPIMIFYAVSDSQIV 79 KKL PK+Y+ + +NI C+S+ LW + W + D + + +D +V Sbjct: 492 KKLEFIPKQYLAEWKRWLENIRDWCISRQLWWGHRIPAWYVTLEDDQLKELGSYNDHWVV 551 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.139 0.409 Gapped Lambda K H 0.267 0.0760 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,336,222 Number of extensions: 133964 Number of successful extensions: 306 Number of sequences better than 10.0: 1 Number of HSP's gapped: 302 Number of HSP's successfully gapped: 35 Length of query: 146 Length of database: 5,994,473 Length adjustment: 84 Effective length of query: 62 Effective length of database: 4,179,401 Effective search space: 259122862 Effective search space used: 259122862 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (23.7 bits)