Query         gi|254781001|ref|YP_003065414.1| hypothetical protein CLIBASIA_04510 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 93
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Wed Jun  1 11:01:12 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781001.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1tdja1 c.79.1.1 (A:5-335) Thr   9.5      53  0.0038   13.5   1.2   46    3-49      4-61  (331)
  2 d1v97a4 d.87.2.1 (A:415-528) X   4.1 1.2E+02  0.0091   11.5   1.5   19   37-55     83-101 (114)
  3 d2diga1 b.34.9.1 (A:8-62) Lami   3.8      43  0.0031   13.9  -1.9   27   40-66      1-27  (55)
  4 d1xmpa_ c.23.8.1 (A:) N5-CAIR    3.4 1.5E+02   0.011   11.1   0.9   12   34-45     98-109 (155)
  5 d1atxa_ g.9.1.1 (A:) Sea anemo   3.4   1E+02  0.0075   12.0  -0.2   13   31-45     20-32  (46)
  6 d1u11a_ c.23.8.1 (A:) N5-CAIR    3.1 1.6E+02   0.011   11.0   0.9   12   34-45     99-110 (159)
  7 d3cu3a1 d.17.4.28 (A:9-170) Un   2.7 1.8E+02   0.013   10.7   1.3   12   78-89    147-158 (162)
  8 d1jb0d_ d.187.1.1 (D:) Photosy   2.5      93  0.0068   12.2  -1.3   17   30-46     27-47  (138)
  9 d2o8ra1 a.7.15.1 (A:4-112) Pol   2.3   2E+02   0.014   10.4   1.8   46   34-90     36-86  (109)
 10 d2fpoa1 c.66.1.46 (A:10-192) M   2.2 1.8E+02   0.013   10.7  -0.2   21   72-92     11-35  (183)

No 1  
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]}
Probab=9.51  E-value=53  Score=13.48  Aligned_cols=46  Identities=17%  Similarity=0.172  Sum_probs=23.1

Q ss_pred             CCCCCHHHHHH-HHHHHHHHHHHCCCHHHHH----------HHHHH-HHCCCCCEEHHH
Q ss_conf             46725667788-9999999984086311543----------15366-507788620355
Q gi|254781001|r    3 ISSPSLSDYLK-IEHYMLHSFIEGPTKAIVI----------IWLSI-FSMPSGSIEYRD   49 (93)
Q Consensus         3 isspslsdylk-iehymlhsfiegptkaivi----------iwlsi-fsmpsgsieyrd   49 (93)
                      -++|+++||+| |..--...+ -++|--+-.          ||+-. +-.|+||...|-
T Consensus         4 ~~~p~~~d~~~~i~~~~v~~~-~~~TPL~~~~~L~~~lg~~i~~K~E~~nptGS~KdRg   61 (331)
T d1tdja1           4 SGAPEGAEYLRAVLRAPVYEA-AQVTPLQKMEKLSSRLDNVILVKREDRQPVHSFKLRG   61 (331)
T ss_dssp             SSCCCHHHHHHHHHHCCGGGT-CCCCCEEECHHHHHHTTSEEEEECGGGSTTSSSTHHH
T ss_pred             CCCCCHHHHHHHHHHCCCCEE-CCCCCEEEHHHHHHHHCCEEEEEECCCCCCCCHHHHH
T ss_conf             989981899999972543000-5678406887864987998999989899887819999


No 2  
>d1v97a4 d.87.2.1 (A:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]}
Probab=4.13  E-value=1.2e+02  Score=11.50  Aligned_cols=19  Identities=37%  Similarity=0.494  Sum_probs=12.1

Q ss_pred             HHHCCCCCEEHHHHHHHHH
Q ss_conf             6507788620355677764
Q gi|254781001|r   37 IFSMPSGSIEYRDTLDERV   55 (93)
Q Consensus        37 ifsmpsgsieyrdtlderv   55 (93)
                      +.+.+.+|.|||-+|-...
T Consensus        83 ~~d~~g~saeYRk~l~~~l  101 (114)
T d1v97a4          83 SPDAPGGMIEFRRTLTLSF  101 (114)
T ss_dssp             CTTCTTCCHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHH
T ss_conf             8688898799999999999


No 3  
>d2diga1 b.34.9.1 (A:8-62) Lamin-b receptor {Human (Homo sapiens) [TaxId: 9606]}
Probab=3.76  E-value=43  Score=13.93  Aligned_cols=27  Identities=30%  Similarity=0.379  Sum_probs=20.0

Q ss_pred             CCCCCEEHHHHHHHHHHCCCHHHHHHH
Q ss_conf             778862035567776412637888899
Q gi|254781001|r   40 MPSGSIEYRDTLDERVANSGLYMIVKK   66 (93)
Q Consensus        40 mpsgsieyrdtldervansglymivkk   66 (93)
                      ||+-+.+--++.-.|-.+|.||.-|+-
T Consensus         1 MP~~k~~~Ge~vm~RwPgSsLyyev~v   27 (55)
T d2diga1           1 MPSRKFADGEVVRGRWPGSSLYYEVEI   27 (55)
T ss_dssp             SCCCSSCSSCEEEEECTTTCCEEEEEE
T ss_pred             CCCCCCCCCCEEEEECCCCCEEEEEEE
T ss_conf             985212478487730699835899999


No 4  
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]}
Probab=3.41  E-value=1.5e+02  Score=11.14  Aligned_cols=12  Identities=50%  Similarity=0.697  Sum_probs=8.8

Q ss_pred             HHHHHHCCCCCE
Q ss_conf             536650778862
Q gi|254781001|r   34 WLSIFSMPSGSI   45 (93)
Q Consensus        34 wlsifsmpsgsi   45 (93)
                      -||+..||+|--
T Consensus        98 llS~vqMP~Gip  109 (155)
T d1xmpa_          98 LLSIVQMPGGVP  109 (155)
T ss_dssp             HHHHHCCCTTCC
T ss_pred             HHHHHHCCCCCC
T ss_conf             899984746899


No 5  
>d1atxa_ g.9.1.1 (A:) Sea anemone toxin IA {Sea anemone (Anemonia sulcata) [TaxId: 6108]}
Probab=3.37  E-value=1e+02  Score=11.95  Aligned_cols=13  Identities=46%  Similarity=0.843  Sum_probs=8.9

Q ss_pred             HHHHHHHHHCCCCCE
Q ss_conf             431536650778862
Q gi|254781001|r   31 VIIWLSIFSMPSGSI   45 (93)
Q Consensus        31 viiwlsifsmpsgsi   45 (93)
                      -+||+  |+-|||=-
T Consensus        20 Gtvw~--~gCpsGWh   32 (46)
T d1atxa_          20 GTIWV--FGCPSGWN   32 (46)
T ss_dssp             EEEES--SCCCTTCE
T ss_pred             EEEEE--CCCCCHHH
T ss_conf             45784--45864043


No 6  
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]}
Probab=3.14  E-value=1.6e+02  Score=10.99  Aligned_cols=12  Identities=50%  Similarity=0.697  Sum_probs=9.0

Q ss_pred             HHHHHHCCCCCE
Q ss_conf             536650778862
Q gi|254781001|r   34 WLSIFSMPSGSI   45 (93)
Q Consensus        34 wlsifsmpsgsi   45 (93)
                      -+|+..||+|--
T Consensus        99 l~S~~qMP~g~p  110 (159)
T d1u11a_          99 LLSIVQMPGGVP  110 (159)
T ss_dssp             HHHHHCCCTTSC
T ss_pred             HHHHHHCCCCCC
T ss_conf             788865767999


No 7  
>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]}
Probab=2.66  E-value=1.8e+02  Score=10.69  Aligned_cols=12  Identities=50%  Similarity=0.537  Sum_probs=8.5

Q ss_pred             CCHHHHHHHHHH
Q ss_conf             532578889875
Q gi|254781001|r   78 VPSRQVTDLYKE   89 (93)
Q Consensus        78 vpsrqvtdlyke   89 (93)
                      .-.|||+|+|-+
T Consensus       147 ~~~r~~~~~~~~  158 (162)
T d3cu3a1         147 EAQRQVTDLVAS  158 (162)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHH
T ss_conf             432101067788


No 8  
>d1jb0d_ d.187.1.1 (D:) Photosystem I subunit PsaD {Synechococcus elongatus [TaxId: 32046]}
Probab=2.52  E-value=93  Score=12.18  Aligned_cols=17  Identities=35%  Similarity=0.817  Sum_probs=11.5

Q ss_pred             HHHHHHH----HHHCCCCCEE
Q ss_conf             5431536----6507788620
Q gi|254781001|r   30 IVIIWLS----IFSMPSGSIE   46 (93)
Q Consensus        30 iviiwls----ifsmpsgsie   46 (93)
                      -+|.|-|    +|.||.|.-.
T Consensus        27 YaITWts~keqvFEmPTGGAA   47 (138)
T d1jb0d_          27 YAITWTSPKEQVFEMPTAGAA   47 (138)
T ss_dssp             EEEEEEESSCEEEECTTSSEE
T ss_pred             EEEEECCCCCCEEECCCCHHH
T ss_conf             789841771424653675044


No 9  
>d2o8ra1 a.7.15.1 (A:4-112) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]}
Probab=2.32  E-value=2e+02  Score=10.44  Aligned_cols=46  Identities=24%  Similarity=0.304  Sum_probs=0.0

Q ss_pred             HHHHHHCCCCCEEHHHHHHH----HHHCCCHH-HHHHHHHHHHHHHHCCCCHHHHHHHHHHH
Q ss_conf             53665077886203556777----64126378-88899876411000025325788898751
Q gi|254781001|r   34 WLSIFSMPSGSIEYRDTLDE----RVANSGLY-MIVKKALVRSKKRKIAVPSRQVTDLYKET   90 (93)
Q Consensus        34 wlsifsmpsgsieyrdtlde----rvansgly-mivkkalvrskkrkiavpsrqvtdlyket   90 (93)
                      .|+|||         ..|||    |||  ||. ++-+.............|..+...+.+.+
T Consensus        36 Fl~I~s---------sNLDEFFmVRVA--gLk~~~~~~~~~~~~~~d~~~~~~~L~~I~~~v   86 (109)
T d2o8ra1          36 FLSIFS---------SNLEEFYTVRVA--YHQAVLQKRRDRSEAEEDSDADAHILQAIRETV   86 (109)
T ss_dssp             HHHHHH---------HHHHHHHHHHHH--HHHHHTTC---------------CHHHHHHHHH
T ss_pred             HHHHHH---------HHHHHHHHHHHH--HHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             999998---------418899999999--999999863155665656568899999999999


No 10 
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}
Probab=2.17  E-value=1.8e+02  Score=10.69  Aligned_cols=21  Identities=52%  Similarity=0.830  Sum_probs=0.0

Q ss_pred             HHHHCCCCH----HHHHHHHHHHCC
Q ss_conf             100002532----578889875148
Q gi|254781001|r   72 KKRKIAVPS----RQVTDLYKETLF   92 (93)
Q Consensus        72 kkrkiavps----rqvtdlyketlf   92 (93)
                      |.|+|.+|.    |..+|.-+|.+|
T Consensus        11 kg~~l~~~~~~~~RPt~~~vre~lf   35 (183)
T d2fpoa1          11 RGRKLPVPDSPGLRPTTDRVRETLF   35 (183)
T ss_dssp             TTCEEECCCC------CHHHHHHHH
T ss_pred             CCCEECCCCCCCCCCCCHHHHHHHH
T ss_conf             8978568999995868389999997


Done!