BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781001|ref|YP_003065414.1| hypothetical protein CLIBASIA_04510 [Candidatus Liberibacter asiaticus str. psy62] (93 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781001|ref|YP_003065414.1| hypothetical protein CLIBASIA_04510 [Candidatus Liberibacter asiaticus str. psy62] gi|254040678|gb|ACT57474.1| hypothetical protein CLIBASIA_04510 [Candidatus Liberibacter asiaticus str. psy62] Length = 93 Score = 181 bits (459), Expect = 3e-44, Method: Composition-based stats. Identities = 93/93 (100%), Positives = 93/93 (100%) Query: 1 MTISSPSLSDYLKIEHYMLHSFIEGPTKAIVIIWLSIFSMPSGSIEYRDTLDERVANSGL 60 MTISSPSLSDYLKIEHYMLHSFIEGPTKAIVIIWLSIFSMPSGSIEYRDTLDERVANSGL Sbjct: 1 MTISSPSLSDYLKIEHYMLHSFIEGPTKAIVIIWLSIFSMPSGSIEYRDTLDERVANSGL 60 Query: 61 YMIVKKALVRSKKRKIAVPSRQVTDLYKETLFP 93 YMIVKKALVRSKKRKIAVPSRQVTDLYKETLFP Sbjct: 61 YMIVKKALVRSKKRKIAVPSRQVTDLYKETLFP 93 >gi|238754704|ref|ZP_04616056.1| HTH-type transcriptional repressor fabR [Yersinia ruckeri ATCC 29473] gi|238707012|gb|EEP99377.1| HTH-type transcriptional repressor fabR [Yersinia ruckeri ATCC 29473] Length = 211 Score = 38.9 bits (89), Expect = 0.22, Method: Composition-based stats. Identities = 30/77 (38%), Positives = 43/77 (55%), Gaps = 10/77 (12%) Query: 8 LSDYLKIEHYMLHSFIEGPTKAIVIIWLSIFSMPSG----SIEYRDTLDERVANSGLYMI 63 L+DYL++EH+M SF E +A+V I +FS + IE R L+ER+ L MI Sbjct: 135 LADYLELEHHMPRSFTEAQAEAMVTI---VFSAGAEVLDVDIEQRRQLEERLVLQ-LRMI 190 Query: 64 VKKAL--VRSKKRKIAV 78 K A R ++ K+AV Sbjct: 191 SKGAYYWYRREQEKLAV 207 >gi|238750872|ref|ZP_04612370.1| HTH-type transcriptional repressor fabR [Yersinia rohdei ATCC 43380] gi|238711016|gb|EEQ03236.1| HTH-type transcriptional repressor fabR [Yersinia rohdei ATCC 43380] Length = 210 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 10/77 (12%) Query: 8 LSDYLKIEHYMLHSFIEGPTKAIVIIWLSIFSMPSGS----IEYRDTLDERVANSGLYMI 63 L+DYL++E++M SF E +A+V I +FS + + IE R L+ER+ L MI Sbjct: 135 LADYLELENHMPRSFTEAQAEAMVTI---VFSAGAEALDVDIEQRRQLEERLVLQ-LRMI 190 Query: 64 VKKAL--VRSKKRKIAV 78 K A R ++ K+AV Sbjct: 191 SKGAYYWYRREQEKLAV 207 >gi|238794890|ref|ZP_04638489.1| HTH-type transcriptional repressor fabR [Yersinia intermedia ATCC 29909] gi|238725765|gb|EEQ17320.1| HTH-type transcriptional repressor fabR [Yersinia intermedia ATCC 29909] Length = 210 Score = 36.2 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 10/77 (12%) Query: 8 LSDYLKIEHYMLHSFIEGPTKAIVIIWLSIFSMPSG----SIEYRDTLDERVANSGLYMI 63 L+DYL++E++M SF E +A+V I +FS + IE R L+ER+ L MI Sbjct: 135 LADYLELENHMPRSFTEAQAEAMVTI---VFSAGAEVLDVDIEQRRQLEERLVLQ-LRMI 190 Query: 64 VKKAL--VRSKKRKIAV 78 K A R ++ K+AV Sbjct: 191 SKGAYYWYRREQEKLAV 207 >gi|238789622|ref|ZP_04633406.1| HTH-type transcriptional repressor fabR [Yersinia frederiksenii ATCC 33641] gi|238722375|gb|EEQ14031.1| HTH-type transcriptional repressor fabR [Yersinia frederiksenii ATCC 33641] Length = 211 Score = 36.2 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 10/77 (12%) Query: 8 LSDYLKIEHYMLHSFIEGPTKAIVIIWLSIFSMPSG----SIEYRDTLDERVANSGLYMI 63 L+DYL++E++M SF E +A+V I +FS + IE R L+ER+ L MI Sbjct: 135 LADYLELENHMPRSFTEAQAEAMVTI---VFSAGAEVLDVDIEQRRQLEERLVLQ-LRMI 190 Query: 64 VKKAL--VRSKKRKIAV 78 K A R ++ K+AV Sbjct: 191 SKGAYYWYRREQEKLAV 207 >gi|238798325|ref|ZP_04641809.1| HTH-type transcriptional repressor fabR [Yersinia mollaretii ATCC 43969] gi|238717872|gb|EEQ09704.1| HTH-type transcriptional repressor fabR [Yersinia mollaretii ATCC 43969] Length = 211 Score = 36.2 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 10/77 (12%) Query: 8 LSDYLKIEHYMLHSFIEGPTKAIVIIWLSIFSMPSG----SIEYRDTLDERVANSGLYMI 63 L+DYL++E++M SF E +A+V I +FS + IE R L+ER+ L MI Sbjct: 135 LADYLELENHMPRSFTEAQAEAMVTI---VFSAGAEVLDVDIEQRRQLEERLVLQ-LRMI 190 Query: 64 VKKAL--VRSKKRKIAV 78 K A R ++ K+AV Sbjct: 191 SKGAYYWYRREQEKLAV 207 >gi|307128961|ref|YP_003880977.1| DNA-binding transcriptional regulatory protein FabR [Dickeya dadantii 3937] gi|306526490|gb|ADM96420.1| DNA-binding transcriptional regulatory protein FabR [Dickeya dadantii 3937] Length = 212 Score = 35.4 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 8/72 (11%) Query: 8 LSDYLKIEHYMLHSFIEGPTKAIVIIWLSIFSMPSGS----IEYRDTLDERVANSGLYMI 63 L+DYL++E+++ SF E +A+VII +FS + + IE R L+ER+ L MI Sbjct: 136 LADYLEVENHIPRSFAEAQAEAMVII---VFSAGAEALDVDIEQRRQLEERLVLQ-LRMI 191 Query: 64 VKKALVRSKKRK 75 K A +K + Sbjct: 192 AKGAYYWYRKEQ 203 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.320 0.135 0.380 Lambda K H 0.267 0.0414 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 797,422,926 Number of Sequences: 14124377 Number of extensions: 26107240 Number of successful extensions: 51644 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 12 Number of HSP's that attempted gapping in prelim test: 51638 Number of HSP's gapped (non-prelim): 13 length of query: 93 length of database: 4,842,793,630 effective HSP length: 63 effective length of query: 30 effective length of database: 3,952,957,879 effective search space: 118588736370 effective search space used: 118588736370 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 75 (33.5 bits)