RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781001|ref|YP_003065414.1| hypothetical protein CLIBASIA_04510 [Candidatus Liberibacter asiaticus str. psy62] (93 letters) >1v97_A XD, xanthine dehydrogenase; molybdopterin, FYX-051, reaction intermediate, oxidoreductase; HET: MTE FAD FYX; 1.94A {Bos taurus} (A:285-540,A:1311-1332) Length = 278 Score = 25.4 bits (55), Expect = 2.8 Identities = 13/50 (26%), Positives = 19/50 (38%) Query: 37 IFSMPSGSIEYRDTLDERVANSGLYMIVKKALVRSKKRKIAVPSRQVTDL 86 P G IE+R TL ++KK SK + + + T L Sbjct: 213 SPDAPGGMIEFRRTLTLSFFFKFYLTVLKKLGKDSKDKCGKLDPDKFTTL 262 >1zbm_A Hypothetical protein AF1704; alpha-beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Archaeoglobus fulgidus dsm 4304} (A:89-178) Length = 90 Score = 24.2 bits (53), Expect = 7.0 Identities = 8/23 (34%), Positives = 14/23 (60%) Query: 62 MIVKKALVRSKKRKIAVPSRQVT 84 ++V K+ + ++IAVP R T Sbjct: 4 VVVAKSEISLDGKRIAVPGRYTT 26 >1xjj_A Ribonucleotide reductase, B12-dependent; 10 alpha-beta barrel, allosteric regulation, substrate specificity, protein-nucleotide complex; HET: DGT; 1.86A {Thermotoga maritima} PDB: 1xjf_A* 1xjg_A* 1xje_A* 1xjk_A* 1xjm_A* 1xjn_A* (A:1-504,A:574-644) Length = 575 Score = 23.9 bits (51), Expect = 7.3 Identities = 11/82 (13%), Positives = 25/82 (30%), Gaps = 4/82 (4%) Query: 11 YLKIEHYMLHSFIEGPTKAIVIIWLSIFSMPSGSIEYRDTLDERVANSGLYMIVKKALVR 70 L I H + FI+ + L+ F++ G + + + G + Sbjct: 214 ILNINHPDIEEFIDAKKENTGEAVLNFFNLSVGFPMDKKEILKLYEEDGELELSH----P 269 Query: 71 SKKRKIAVPSRQVTDLYKETLF 92 + V R++ + Sbjct: 270 RSTIRKKVKIRELFRKIATNAW 291 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.320 0.135 0.380 Gapped Lambda K H 0.267 0.0733 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 664,501 Number of extensions: 25197 Number of successful extensions: 36 Number of sequences better than 10.0: 1 Number of HSP's gapped: 36 Number of HSP's successfully gapped: 3 Length of query: 93 Length of database: 4,956,049 Length adjustment: 54 Effective length of query: 39 Effective length of database: 3,130,579 Effective search space: 122092581 Effective search space used: 122092581 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.0 bits)