RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781002|ref|YP_003065415.1| hypothetical protein CLIBASIA_04515 [Candidatus Liberibacter asiaticus str. psy62] (108 letters) >gnl|CDD|148330 pfam06664, MIG-14_Wnt-bd, Wnt-binding factor required for Wnt secretion. MIG-14 is a Wnt-binding factor. Newly synthesized EGL-20/Wnt binds to MIG-14 in the Golgi, targetting the Wnt to the cell membrane for secretion. AP-2-mediated endocytosis and retromer retrieval at the sorting endosome would recycle MIG-14 to the Golgi, where it can bind to EGL-20/Wnt for next cycle of secretion. Length = 291 Score = 28.4 bits (64), Expect = 0.36 Identities = 19/84 (22%), Positives = 34/84 (40%), Gaps = 1/84 (1%) Query: 3 EMIFFAFVFTCILLLWCVFIGLIACWIVDRWEYFFIRRKYVLTAILLNYQFFYSLQTIFS 62 M+F V C LL+ +F+ + + Y F R K+++ LL +L FS Sbjct: 196 AMVFILIVGICAYLLYLIFLIIKVFSELRTRRYSFYRYKFLMLFTLLCAAITVALLGNFS 255 Query: 63 VEHYT-NPHSIILAFVWSILSFFI 85 T S + +L+ ++ Sbjct: 256 SSFSTYYSSSAFFLGFYGLLNIYV 279 >gnl|CDD|165718 PLN00150, PLN00150, potassium ion transporter family protein; Provisional. Length = 779 Score = 28.3 bits (63), Expect = 0.45 Identities = 13/47 (27%), Positives = 20/47 (42%), Gaps = 13/47 (27%) Query: 8 AFVFTCILLLWCVFIGLIACWIVDRWE-------------YFFIRRK 41 +F+F I L W + LI C+ + +W+ FFIR Sbjct: 237 SFLFAPIFLCWFFSLALIGCYNIIKWDKSVFLAFNPLYIVSFFIRNG 283 >gnl|CDD|147912 pfam06011, TRP, Transient receptor potential (TRP) ion channel. This family of proteins are transient receptor potential (TRP) ion channels. They are essential for cellular viability and are involved in cell growth and cell wall synthesis. The genes for these proteins are homologous to polycystic kidney disease related ion channel genes. Length = 532 Score = 28.0 bits (63), Expect = 0.51 Identities = 21/112 (18%), Positives = 42/112 (37%), Gaps = 10/112 (8%) Query: 4 MIFFAFVFTCILLLWCVFIGLIACWIV------DRWEYFFIRRKYVLTAILLNYQFFYSL 57 IFF I++L F ++ D++ F + L LL + Sbjct: 254 FIFFLIFIALIVVLVIQFKFILELLARFGKMKPDKFAEFRKKWWPFLKGTLLRLVLIFFP 313 Query: 58 Q-TIFSVEHYTN---PHSIILAFVWSILSFFITFWIFVASVSMGRRVIQYFK 105 I S+ +T +++LA V+ L + W +S+ R+ ++ + Sbjct: 314 PIVILSLWQFTQADSAAAVVLAVVFLALLLGLLGWAAFRVISIARKSVRLYG 365 >gnl|CDD|178257 PLN02651, PLN02651, cysteine desulfurase. Length = 364 Score = 26.5 bits (59), Expect = 1.6 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 61 FSVEHYTNPHSIILAFVW 78 F +EH+ NPHS + W Sbjct: 22 FLIEHFGNPHSRTHLYGW 39 >gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter. This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc. Length = 708 Score = 25.5 bits (56), Expect = 3.0 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Query: 41 KYVLTAILLNYQFFYSLQTIFSVEHYTNPHSIILAFVWSILSFFITFWIFVA-SVSMGRR 99 Y+ L FF + +T V +T+ SII A +ILS F+ WI V + + R+ Sbjct: 234 SYIKHLFELPMSFFSTRRTGEIVSRFTDASSIIDALASTILSLFLDMWILVIVGLFLVRQ 293 Query: 100 VIQYF 104 + F Sbjct: 294 NMLLF 298 >gnl|CDD|184256 PRK13700, PRK13700, conjugal transfer protein TraD; Provisional. Length = 732 Score = 25.3 bits (55), Expect = 3.3 Identities = 9/31 (29%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 3 EMIFFAFVF-TCILLLWCVFIGLIACWIVDR 32 E ++ AFV + L+ C+ + WI+ R Sbjct: 106 EQLWSAFVLAAVVALVICLITFFVVSWILGR 136 >gnl|CDD|177505 PHA03000, PHA03000, Hypothetical protein; Provisional. Length = 566 Score = 25.0 bits (55), Expect = 4.3 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 37 FIRRKYVLTAILLNYQF----FYSLQTIFSVEHYTNPHSIILAFVWSILS 82 FIRRKY++ I N F S + FS+ H ++L F +++ Sbjct: 3 FIRRKYLIYTIENNIDFLRDEVLSKVSNFSLNHVLALKYLVLNFPKDVIT 52 >gnl|CDD|183693 PRK12705, PRK12705, hypothetical protein; Provisional. Length = 508 Score = 24.7 bits (54), Expect = 5.2 Identities = 6/40 (15%), Positives = 11/40 (27%), Gaps = 7/40 (17%) Query: 2 MEMIFFAFVFTCILLLWCVFIGLIACWIVDRWEYFFIRRK 41 M + + IGL+ +V + K Sbjct: 1 FAMSILLVILL-------LLIGLLLGVLVVLLKKRQRLAK 33 >gnl|CDD|162177 TIGR01054, rgy, reverse gyrase. Generally, these gyrases are encoded as a single polypeptide. An exception was found in Methanopyrus kandleri, where enzyme is split within the topoisomerase domain, yielding a heterodimer of gene products designated RgyB and RgyA. Length = 1171 Score = 24.8 bits (54), Expect = 5.8 Identities = 12/44 (27%), Positives = 17/44 (38%), Gaps = 10/44 (22%) Query: 11 FTCILLLWCVFIG----------LIACWIVDRWEYFFIRRKYVL 44 FT LW F + WI+DR+ +R Y+L Sbjct: 794 FTLSQKLWEAFNKRWLSAGRVQTPVLGWIIDRYRESREKRGYLL 837 >gnl|CDD|184523 PRK14125, PRK14125, cell division suppressor protein YneA; Provisional. Length = 103 Score = 24.6 bits (54), Expect = 6.1 Identities = 5/37 (13%), Positives = 13/37 (35%), Gaps = 5/37 (13%) Query: 1 MMEMIFFAFVFTCILLLWCVFIGLIACW--IVDRWEY 35 + E +F + + + + VD+ +Y Sbjct: 3 LKESKIHVSIFFVLT---ALVLLIFVYATVPVDKNQY 36 >gnl|CDD|181034 PRK07566, PRK07566, bacteriochlorophyll/chlorophyll a synthase; Reviewed. Length = 314 Score = 24.5 bits (54), Expect = 6.4 Identities = 6/30 (20%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Query: 69 PHSIILAFVWSILSFFITF----WIFVASV 94 + L V ++L + + W+F+A++ Sbjct: 110 RWVLYLIAVLTVLGLAVAYLLGPWVFLAAL 139 >gnl|CDD|183224 PRK11598, PRK11598, putative metal dependent hydrolase; Provisional. Length = 545 Score = 24.3 bits (53), Expect = 6.9 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 20/74 (27%) Query: 1 MMEMIF-------FAFVFTCILLLWCVFIGL----IACWI-----VDRWEYFFIRRKYVL 44 M++ IF FA + T +LLW G+ IACWI RW R +L Sbjct: 103 MIQNIFETTPAESFA-LMTPQMLLWLGLSGVLPALIACWIKIRPATPRWRSVLFRLANIL 161 Query: 45 TA---ILLNYQFFY 55 + ILL FY Sbjct: 162 VSVLLILLVAALFY 175 >gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional. Length = 547 Score = 24.2 bits (53), Expect = 6.9 Identities = 11/48 (22%), Positives = 16/48 (33%), Gaps = 11/48 (22%) Query: 37 FIRRKYVLTAILLNYQFFYSLQTIFSVEHYTNPHSIILAFVWSILSFF 84 I+ Y+ A+LL Y + + F W LS F Sbjct: 6 HIKYYYLAGALLLLYLAVTGPSILLTF-----------LFAWISLSLF 42 >gnl|CDD|162065 TIGR00844, c_cpa1, na(+)/h(+) antiporter. This model is specific for the fungal members of this family. Length = 810 Score = 24.1 bits (52), Expect = 7.3 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Query: 47 ILLNYQFFYSLQTIFSVEHYTNPHSIILAFVWS--ILSFFITFWIFVASVSMGRRVIQYF 104 +LLNY +F L +I + + N I VW ILS + F + +V + + +I Sbjct: 298 VLLNYAYFVYLGSILPWKDFNNGD--IGLDVWRLIILSLVVIFLRRIPAVLILKPLIPDI 355 Query: 105 KRSR 108 K R Sbjct: 356 KSWR 359 >gnl|CDD|181819 PRK09395, actP, acetate permease; Provisional. Length = 551 Score = 24.2 bits (53), Expect = 7.6 Identities = 7/22 (31%), Positives = 14/22 (63%) Query: 67 TNPHSIILAFVWSILSFFITFW 88 TN +II+ ++ + + IT+W Sbjct: 32 TNWQAIIMFLIFVVFTLGITYW 53 >gnl|CDD|130079 TIGR01006, polys_exp_MPA1, polysaccharide export protein, MPA1 family, Gram-positive type. This family contains members from Low GC Gram-positive bacteria; they are proposed to have a function in the export of complex polysaccharides. Length = 226 Score = 24.0 bits (52), Expect = 9.5 Identities = 8/18 (44%), Positives = 14/18 (77%) Query: 72 IILAFVWSILSFFITFWI 89 +I+A ++ I+SF TF+I Sbjct: 25 LIVALIFLIISFIYTFFI 42 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.344 0.148 0.521 Gapped Lambda K H 0.267 0.0726 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,829,330 Number of extensions: 108743 Number of successful extensions: 888 Number of sequences better than 10.0: 1 Number of HSP's gapped: 867 Number of HSP's successfully gapped: 149 Length of query: 108 Length of database: 5,994,473 Length adjustment: 74 Effective length of query: 34 Effective length of database: 4,395,481 Effective search space: 149446354 Effective search space used: 149446354 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.6 bits) S2: 50 (23.0 bits)