RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254781002|ref|YP_003065415.1| hypothetical protein
CLIBASIA_04515 [Candidatus Liberibacter asiaticus str. psy62]
         (108 letters)



>1wjo_A T-plastin; CH domain, actin binding, structural genomics,
           riken structural genomics/proteomics initiative, RSGI,
           protein binding; NMR {Homo sapiens} (A:)
          Length = 124

 Score = 23.8 bits (51), Expect = 9.4
 Identities = 8/75 (10%), Positives = 19/75 (25%), Gaps = 13/75 (17%)

Query: 23  GLIACWIVDRWEYFFIRRKYVLTAILLNYQFFYSLQTIFS------VEHYTNPHSI---- 72
            L    ++D  +   I    V +  L       + +   S         Y  P  +    
Sbjct: 40  SLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVK 99

Query: 73  ---ILAFVWSILSFF 84
              ++     ++   
Sbjct: 100 PKMVMTVFACLMGRG 114


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.344    0.148    0.521 

Gapped
Lambda     K      H
   0.267   0.0580    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 885,069
Number of extensions: 35272
Number of successful extensions: 221
Number of sequences better than 10.0: 1
Number of HSP's gapped: 220
Number of HSP's successfully gapped: 39
Length of query: 108
Length of database: 4,956,049
Length adjustment: 64
Effective length of query: 44
Effective length of database: 2,792,529
Effective search space: 122871276
Effective search space used: 122871276
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 38 (21.6 bits)
S2: 50 (23.4 bits)