RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254781002|ref|YP_003065415.1| hypothetical protein
CLIBASIA_04515 [Candidatus Liberibacter asiaticus str. psy62]
         (108 letters)



>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 32.2 bits (73), Expect = 0.031
 Identities = 20/95 (21%), Positives = 30/95 (31%), Gaps = 42/95 (44%)

Query: 19  CVFIGLIA-CWIVDRWEYFFIRRKYVLTAILLNY---QFFYSLQTIFSVEHYTNPHS--I 72
           C  IG+I                 YV+TA LL +   +     ++          HS  +
Sbjct: 238 CPLIGVIQLAH-------------YVVTAKLLGFTPGEL----RSYLKG---ATGHSQGL 277

Query: 73  ILAFV------WSILSFF--------ITFWIFVAS 93
           + A        W   SFF        + F+I V  
Sbjct: 278 VTAVAIAETDSWE--SFFVSVRKAITVLFFIGVRC 310



 Score = 27.2 bits (60), Expect = 1.0
 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 13/44 (29%)

Query: 23  GLI-ACWI--VDRWEYFFIRRKYVLTAI-LLNYQFF---YSLQT 59
           GL+ A  I   D WE FF     V  AI +L   FF      + 
Sbjct: 276 GLVTAVAIAETDSWESFF---VSVRKAITVL---FFIGVRCYEA 313


>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken
           structural genomics/proteomics initiative, RSGI, protein
           binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A
          Length = 124

 Score = 24.2 bits (52), Expect = 7.0
 Identities = 7/74 (9%), Positives = 18/74 (24%), Gaps = 15/74 (20%)

Query: 23  GLIACWIVDRWEYFFIRRKYVLTAILLNYQFFYSLQTIFSVEHY--------------TN 68
            L    ++D  +   I    V +  L       + +   S+                   
Sbjct: 40  SLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVK 99

Query: 69  PHSIILAFVWSILS 82
           P  + +     ++ 
Sbjct: 100 PKMV-MTVFACLMG 112


>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A
          {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A
          2r6e_A 2vyf_A 2vye_A
          Length = 454

 Score = 24.1 bits (51), Expect = 8.7
 Identities = 8/34 (23%), Positives = 12/34 (35%), Gaps = 1/34 (2%)

Query: 41 KYVLTAILLNYQFFYSLQTIFSVEHYTNP-HSII 73
          + VL A+ L+         I   E +    H  I
Sbjct: 18 QAVLGAVFLDPAALVPASEILIPEDFYRAAHQKI 51


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.344    0.148    0.521 

Gapped
Lambda     K      H
   0.267   0.0448    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 991,607
Number of extensions: 39690
Number of successful extensions: 258
Number of sequences better than 10.0: 1
Number of HSP's gapped: 252
Number of HSP's successfully gapped: 54
Length of query: 108
Length of database: 5,693,230
Length adjustment: 72
Effective length of query: 36
Effective length of database: 3,947,662
Effective search space: 142115832
Effective search space used: 142115832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 38 (21.6 bits)
S2: 50 (23.7 bits)