BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781002|ref|YP_003065415.1| hypothetical protein CLIBASIA_04515 [Candidatus Liberibacter asiaticus str. psy62] (108 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781002|ref|YP_003065415.1| hypothetical protein CLIBASIA_04515 [Candidatus Liberibacter asiaticus str. psy62] Length = 108 Score = 215 bits (547), Expect = 2e-58, Method: Compositional matrix adjust. Identities = 108/108 (100%), Positives = 108/108 (100%) Query: 1 MMEMIFFAFVFTCILLLWCVFIGLIACWIVDRWEYFFIRRKYVLTAILLNYQFFYSLQTI 60 MMEMIFFAFVFTCILLLWCVFIGLIACWIVDRWEYFFIRRKYVLTAILLNYQFFYSLQTI Sbjct: 1 MMEMIFFAFVFTCILLLWCVFIGLIACWIVDRWEYFFIRRKYVLTAILLNYQFFYSLQTI 60 Query: 61 FSVEHYTNPHSIILAFVWSILSFFITFWIFVASVSMGRRVIQYFKRSR 108 FSVEHYTNPHSIILAFVWSILSFFITFWIFVASVSMGRRVIQYFKRSR Sbjct: 61 FSVEHYTNPHSIILAFVWSILSFFITFWIFVASVSMGRRVIQYFKRSR 108 >gi|254780529|ref|YP_003064942.1| flagellar motor protein MotB [Candidatus Liberibacter asiaticus str. psy62] Length = 343 Score = 23.5 bits (49), Expect = 1.1, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 76 FVWSILSFFITFWIFVASVSMGRRVI-QYF 104 F+ +++FF+ WI A+ ++ I QYF Sbjct: 40 FMTVLMAFFLVMWIINATDDDTKKAIEQYF 69 >gi|254780711|ref|YP_003065124.1| signal recognition particle protein [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 23.1 bits (48), Expect = 1.5, Method: Composition-based stats. Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 57 LQTIFSVEHYTNPHSIIL 74 +Q I ++ TNPH I+L Sbjct: 202 MQEISEIKSLTNPHEILL 219 >gi|254781033|ref|YP_003065446.1| HemY domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 492 Score = 21.9 bits (45), Expect = 3.0, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 11/59 (18%) Query: 48 LLNYQFFYSLQ--TIFSVEHYTNPHSIILA---------FVWSILSFFITFWIFVASVS 95 L+ Y F SL + V HY SI + SIL FF+ WI + +VS Sbjct: 4 LIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVS 62 >gi|254780867|ref|YP_003065280.1| NADH dehydrogenase subunit N [Candidatus Liberibacter asiaticus str. psy62] Length = 478 Score = 21.9 bits (45), Expect = 3.1, Method: Compositional matrix adjust. Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 22 IGLIACWIVDRWEYFFIRRKYVLTAILLNYQFF 54 IGL +I DR+ Y FI+ ++++I++ + F Sbjct: 64 IGLGGAYISDRFSY-FIKAILLMSSIIIFIKMF 95 >gi|254780511|ref|YP_003064924.1| flagellar biosynthesis protein FliR [Candidatus Liberibacter asiaticus str. psy62] Length = 248 Score = 20.4 bits (41), Expect = 9.3, Method: Compositional matrix adjust. Identities = 6/10 (60%), Positives = 9/10 (90%) Query: 22 IGLIACWIVD 31 IGL+A W++D Sbjct: 131 IGLLALWVID 140 >gi|254780690|ref|YP_003065103.1| flagellar biosynthesis protein FlhB [Candidatus Liberibacter asiaticus str. psy62] Length = 354 Score = 20.4 bits (41), Expect = 9.4, Method: Compositional matrix adjust. Identities = 8/30 (26%), Positives = 18/30 (60%) Query: 67 TNPHSIILAFVWSILSFFITFWIFVASVSM 96 NPHSI+ +++ I +F+A++++ Sbjct: 179 ANPHSILYHAFFTVRKVLIMILLFIATLTV 208 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.344 0.148 0.521 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,535 Number of Sequences: 1233 Number of extensions: 2490 Number of successful extensions: 22 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 13 length of query: 108 length of database: 328,796 effective HSP length: 62 effective length of query: 46 effective length of database: 252,350 effective search space: 11608100 effective search space used: 11608100 T: 11 A: 40 X1: 15 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.6 bits) S2: 32 (16.9 bits)