HHsearch alignment for GI: 254781004 and conserved domain: KOG2105

>KOG2105 consensus.
Probab=96.15  E-value=0.018  Score=36.92  Aligned_cols=145  Identities=14%  Similarity=0.262  Sum_probs=93.5

Q ss_pred             CCEEECCCEEEEECCCCHHHH-HHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCEEEEEECC-CCCCHHHHHHHHHHHH
Q ss_conf             745303670798628999999-99999899999999999779988997243588557884088-8888989999999999
Q gi|254781004|r   50 LSDPVREGSIEIITPEDPRSL-AVIRHSCAHIMAEAVQSIWPEVQVAIGPIIEDGFYYDFDKE-QPFSSDELAQIEKKMQ  127 (652)
Q Consensus        50 L~~~l~d~~i~~i~~~~~eg~-~i~~hS~ahlL~~Av~~l~p~~kl~igp~i~~GfYyD~~~~-~~it~~dl~~Ie~~M~  127 (652)
T Consensus        86 ~~~~iePGt~V~V~VD~qkR~D~MQQHsGQHLitAvad~~fK-lkTt-S-WelG~~~sa~e~~~~~mTaeqvaaieqsvN  162 (415)
T KOG2105          86 VNDYIEPGTTVEVAVDEQKRMDYMQQHSGQHLITAVADHLFK-LKTT-S-WELGRFRSAIELDTPSMTAEQVAAIEQSVN  162 (415)
T ss_pred             CCCCCCCCCEEEEEECHHHHHHHHHHHCCHHHHHHHHHHHHC-CCEE-E-EECCCEEECCCCCCCCCCHHHHHHHHHHHH
T ss_conf             378779997699985578774898871322699999976403-2200-3-541451440236888746999987899988


Q ss_pred             HHHHCCCCEEEEECCHHH-HHHHHHHCCCHHHHHHHHHCCCCCCCEEECCCC-CEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             999669980485327678-544544167113556654203455421302575-201000235521444222333333211
Q gi|254781004|r  128 EIIARDSPFLKQYLSHEK-ARELFESKKEAYKVEILESIPAKENVTLYRQGE-WFDLCRGPHVRSTGQVKKFFKLMKVAG  205 (652)
Q Consensus       128 ~ii~~~~pi~r~~vs~~e-A~~~F~~~~~~~K~~li~~~~~~~~v~~y~~g~-~~Dlc~GphvpsTg~ik~~fkL~~~sg  205 (652)
T Consensus       163 e~I~d~~~~~v~E~sl~d~eVeqVS~~~~~D~--------haG~iRvvnI~~vDSN~CCGTHvs~~Sdl~v-I~ILgtek  233 (415)
T KOG2105         163 EKIRDRLPVNVRELSLDDPEVEQVSGRGLPDD--------HAGPIRVVNIEGVDSNMCCGTHVSNLSDLQV-IKILGTEK  233 (415)
T ss_pred             HHHHHCCCHHEEECCCCCCCHHHCCCCCCCCC--------CCCCEEEEEECCCCCCCCCCCCCCCHHHCCE-EEEEECCC
T ss_conf             99873243020101159842200268998544--------6686489853575577640012443311535-89840431


Q ss_pred             H
Q ss_conf             1
Q gi|254781004|r  206 A  206 (652)
Q Consensus       206 a  206 (652)
T Consensus       234 g  234 (415)
T KOG2105         234 G  234 (415)
T ss_pred             C
T ss_conf             3