HHsearch alignment for GI: 254781004 and conserved domain: PRK00413

>PRK00413 thrS threonyl-tRNA synthetase; Reviewed.
Probab=100.00  E-value=0  Score=1691.63  Aligned_cols=631  Identities=54%  Similarity=0.997  Sum_probs=618.4

Q ss_pred             EEECCCCCEEECCCCCCHHHHHHHHCCCCCCCEEEEEECCEEEECCEEE-CCCEEEEECCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             8992899887418988899999863611011289999898899774530-367079862899999999999899999999
Q gi|254781004|r    6 KLTFPDGSIKNFPVHATGSDVAESISRSLAKKAVAVAINGKVCDLSDPV-REGSIEIITPEDPRSLAVIRHSCAHIMAEA   84 (652)
Q Consensus         6 ~I~lpDG~~~~~~~g~t~~dia~~i~~~~~~~~vaa~vng~l~dL~~~l-~d~~i~~i~~~~~eg~~i~~hS~ahlL~~A   84 (652)
T Consensus         1 tItlPDGs~~~~~~~~t~~~iA~~Is~~Lak~avaa~vng~l~Dl~~~l~~d~~leiit~~d~egl~v~rHS~AHvla~A   80 (639)
T PRK00413          1 SITFPDGSVREFPKGVTAAEVAASISPSLAKKAVAGKVNGELVDLSTPIEEDATVEIVTADDEDGLEIIRHSAAHVLAQA   80 (639)
T ss_pred             CEECCCCCEEECCCCCCHHHHHHHHCHHHHHHHEEEEECCEEEECCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHH
T ss_conf             96799998246789999999999979676656089998999974686058997899946999789999888899999999


Q ss_pred             HHHHCCCCEEEEECCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHCCCHHHHHHHHH
Q ss_conf             99977998899724358855788408888889899999999999996699804853276785445441671135566542
Q gi|254781004|r   85 VQSIWPEVQVAIGPIIEDGFYYDFDKEQPFSSDELAQIEKKMQEIIARDSPFLKQYLSHEKARELFESKKEAYKVEILES  164 (652)
Q Consensus        85 v~~l~p~~kl~igp~i~~GfYyD~~~~~~it~~dl~~Ie~~M~~ii~~~~pi~r~~vs~~eA~~~F~~~~~~~K~~li~~  164 (652)
T Consensus        81 v~~l~p~~kl~iGP~ie~GFYYDf~~~~~it~~Dl~~IEk~M~~iik~~~~~~r~~vs~~eA~~~F~~~~~~yK~eli~~  160 (639)
T PRK00413         81 VQRLFPDAKLGIGPVIENGFYYDFDVEEPFTPEDLPAIEKEMKKIIKENLPFTREVVSREEALELFADIGEPYKLELIED  160 (639)
T ss_pred             HHHHCCCCEEEECCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             99977997787789757703672126998998999999999999984799849999189999999986186689999863


Q ss_pred             CCCCCCCEEECCCCCEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             03455421302575201000235521444222333333211101577564206899999837988999999999975320
Q gi|254781004|r  165 IPAKENVTLYRQGEWFDLCRGPHVRSTGQVKKFFKLMKVAGAYWRGDSNRPMLSRIYGTAWNTQQELTQYLYFLEESEKR  244 (652)
Q Consensus       165 ~~~~~~v~~y~~g~~~Dlc~GphvpsTg~ik~~fkL~~~sgayw~gd~~~~~l~Riyg~af~~~~~l~~~~~~~eea~~r  244 (652)
T Consensus       161 ~~~~~~is~Y~~g~f~DLCrGPHv~~t~~ika-fKL~~vsgaYWrGd~~n~~LqRIYG~af~~k~~L~~~l~~~eEakkR  239 (639)
T PRK00413        161 IPEGEEITIYRQGEFVDLCRGPHVPSTGKIKA-FKLLKVAGAYWRGDSKNEMLQRIYGTAWADKEDLDAYLHRLEEAEKR  239 (639)
T ss_pred             CCCCCCEEEEEECCEEEECCCCCCCCCCCCCE-EEEEECCHHHCCCCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHC
T ss_conf             67998579999155789668887765220445-78753141110788667303899998519989999999999998852


Q ss_pred             HHHHHHHHCCEEEECCCCCCEEEEECCHHHHHHHHHHHHHHHH-HCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEC
Q ss_conf             0887541144044226787435650107899999999999887-689638555432443100011210012555420100
Q gi|254781004|r  245 DHRKLAREMDLFHIAEDGSGVIFWHRKGWKIFQTLISYMRRKI-KDDYEEINTPQVLDQHLWQQSGHWDSYRANMFAVKC  323 (652)
Q Consensus       245 dHr~lg~~~~lf~~~~~~~G~~~wlP~G~~i~~~ie~~ir~~~-~~G~~eV~tP~l~~~~Lw~~SGh~~~y~~~mf~~~~  323 (652)
T Consensus       240 DHRklGkel~LF~f~~~~pGl~~w~P~G~~i~~~le~~~r~~~~~~Gy~eV~TP~i~~~~Lw~~SGHw~~Y~e~Mf~~~~  319 (639)
T PRK00413        240 DHRKLGKELDLFSFQEEGPGLPFWHPKGWIIRNELEDYMRRRHLKAGYQEVNTPHILDRSLWETSGHWDHYRENMFPTMS  319 (639)
T ss_pred             CHHHHHHHCCCEEECCCCCCCEEECCCHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHCCCHHHHCCCCCCCEE
T ss_conf             88888774351570366887646637689999999999999999869859836413468899654742232254223240


Q ss_pred             CCCCCCCCCEEEECCCCHHHHHHHHHHCCCCHHHCCHHHHHHEEEECCCCCCCCEEEEECCCCCCCCCEEECCHHHHHHH
Q ss_conf             14567778237743431257777652012222310432000100012787645200010563533442101053767887
Q gi|254781004|r  324 ADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRLAEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMFNE  403 (652)
Q Consensus       324 ~~~~~~~~~~~~LkPmncp~h~~i~~~~~~SYrdLPlrl~e~~~~~R~E~sg~l~GL~R~ReF~~~Dah~F~~~eq~~~e  403 (652)
T Consensus       320 -----~~~~~~~lKPMNCP~H~~if~~~~~SYRdLPlR~aEfg~~~R~E~SG~L~GL~RvR~FtqdDaHIFc~~dQi~~E  394 (639)
T PRK00413        320 -----DDGEDYALKPMNCPGHILIFKSGLRSYRELPLRLAEFGTVHRYEKSGALHGLMRVRGFTQDDAHIFCTPEQIKDE  394 (639)
T ss_pred             -----CCCCEEEECCCCCCCHHHHHHCCCCCHHHCCHHHHHHHHHHCCCCCCCCCCEEEEEEEECCCCEEECCHHHHHHH
T ss_conf             -----152103204668700335644355355547556664113205677874456423300001584132478999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             89999998876655213321000146531125860357789999999998502121256675205555554554321100
Q gi|254781004|r  404 CLKIHNLIISIYKDFGFEKIMVKLSTRPEKRVGSDALWDDAENIMKGVLDTIKNSSQDRINTGVLLGEGAFYGPKFEYIL  483 (652)
Q Consensus       404 ~~~~~~~~~~v~~~~g~~~~~~~ls~~~~~~~g~~~~~~~ae~~l~~~l~~~~~~~~~~~~~~~~~g~~afygpkid~~~  483 (652)
T Consensus       395 i~~~l~~~~~vy~~fGf~~~~~~lStrpek~~g~~e~W~~Ae~~L~~al~~~g------~~y~~~~GegAFYGPKID~~~  468 (639)
T PRK00413        395 LLSVLDLILSVYKDFGLTDYYLELSTRPEKRVGSDELWEKATEALREALEESG------LEYVENPGEGAFYGPKIDVQL  468 (639)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCC------CCEEECCCCCCEECCEEEEEE
T ss_conf             99999999999997499803899964751135888999999999999999749------980878886111101667785


Q ss_pred             HHHCCCCCCCCCCCHHHHCCCCCCCEEEEECCCEEEEEEEEECCCHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCHH
Q ss_conf             21103310012110111022346741673179721379964034103789999999973870887337808999857966
Q gi|254781004|r  484 KDAIGRDWQCGTIQVDFNLPSRFNAFYVNSHSEKCHPVMIHRAVFGSIERFIGIMIENFKGNLPLWLSPIQAIVTTITSS  563 (652)
Q Consensus       484 ~d~~gr~~~~~tiq~df~~p~~f~l~y~~~dg~~~~pvmihr~~~Gs~eR~ia~liE~~~g~~P~wLAP~QV~Iipi~e~  563 (652)
T Consensus       469 ~DalgR~wq~~TiQlDf~lPerF~l~Y~~~dg~~~~PVmIHRAi~GS~ERfiaiLiEh~~G~~P~WLaP~Qv~IipV~~~  548 (639)
T PRK00413        469 KDAIGRTWQCGTIQLDFNLPERFDLEYIAADGEKHRPVMIHRAIFGSIERFIGILIEHYAGAFPLWLAPVQVVVIPITDE  548 (639)
T ss_pred             ECCCCCEEECCHHHHHHCCHHHCCCEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCHH
T ss_conf             14468713200233222245424888998889816308999525565899999999980898873657615899961847


Q ss_pred             HHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHCCCCEEEEECHHHHHCCCEEEEECCCCCEEEECHHHHHHHHHH
Q ss_conf             89999999999998798899975896636766655434898899987425325818999889886633429999999987
Q gi|254781004|r  564 AVEYAQEIANLLKSHHLSIETDFRNETINYKIREHSIKKIPIIIICGDKEASERSIGIRRFGSTTTQKVSLLDAIPILTK  643 (652)
Q Consensus       564 ~~eya~~i~~~L~~~girV~~Ddr~~~~G~Kir~a~l~giP~~ivIG~ke~e~~~Vtir~R~~~~~~~i~lee~i~~l~~  643 (652)
T Consensus       549 ~~~ya~~v~~~l~~~giRv~vD~~~e~l~~KIR~a~~~kiPy~~VvGdkE~~~~~VsvR~r~~~~~~~~~~~efi~~l~~  628 (639)
T PRK00413        549 HADYAKEVAKALRDAGIRVEVDLRNEKIGYKIREAQLQKVPYMLVVGDKEVEAGTVSVRRRGGGDLGTMPVDEFVEKIKE  628 (639)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEEHHHHHCCEEEEEECCCCCCCEEEHHHHHHHHHH
T ss_conf             89999999999997898899978998575999998653799899980036535958999778972465689999999999


Q ss_pred             HCCCH
Q ss_conf             31435
Q gi|254781004|r  644 ESLPP  648 (652)
Q Consensus       644 e~~~~  648 (652)
T Consensus       629 ei~~r  633 (639)
T PRK00413        629 EIARR  633 (639)
T ss_pred             HHHHH
T ss_conf             99875