HHsearch alignment for GI: 254781004 and conserved domain: PRK05431

>PRK05431 seryl-tRNA synthetase; Provisional.
Probab=99.89  E-value=1.6e-22  Score=175.31  Aligned_cols=266  Identities=18%  Similarity=0.321  Sum_probs=210.1

Q ss_pred             HHHHHHHHHHHCCEEEECC----CCCCEEEEECCHHHHHHHHHHHHHH-HHHCCCEEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             3200887541144044226----7874356501078999999999998-8768963855543244310001121001255
Q gi|254781004|r  242 EKRDHRKLAREMDLFHIAE----DGSGVIFWHRKGWKIFQTLISYMRR-KIKDDYEEINTPQVLDQHLWQQSGHWDSYRA  316 (652)
Q Consensus       242 ~~rdHr~lg~~~~lf~~~~----~~~G~~~wlP~G~~i~~~ie~~ir~-~~~~G~~eV~tP~l~~~~Lw~~SGh~~~y~~  316 (652)
T Consensus       135 ~~k~H~elge~l~liDfe~aaKiSGsRF~~Lkg~~A~LerALi~f~ld~~~~~Gy~~v~~P~lv~~~~~~gtGqlPkfe~  214 (422)
T PRK05431        135 EPKDHWELGEKLGILDFERAAKVSGSRFYVLKGDGARLERALIQFMLDLHTEEGYTEVIPPYLVNEESMYGTGQLPKFEE  214 (422)
T ss_pred             CCCCHHHHHHHCCCCCHHHHHHHCCCCEEEEHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHCCCCCCHH
T ss_conf             88778899876476104667755078704600489999999999999999987997996737636788744537974487


Q ss_pred             CCCEEECCCCCCCCCCEEEECCCCHHHHHHHHHHCCCCHHHCCHHHHHHEEEECCCCCC---CCEEEEECCCCCCCCCEE
Q ss_conf             54201001456777823774343125777765201222231043200010001278764---520001056353344210
Q gi|254781004|r  317 NMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRLAEFGSVYRNEPSG---SLHGLMRVRGFTQDDAHV  393 (652)
Q Consensus       317 ~mf~~~~~~~~~~~~~~~~LkPmncp~h~~i~~~~~~SYrdLPlrl~e~~~~~R~E~sg---~l~GL~R~ReF~~~Dah~  393 (652)
T Consensus       215 ~~Y~i~--------~~dl~Li~TAEvpL~~~~~~eil~~~~LPik~~~~S~CFR~EAGs~GkdtrGl~RvHQF~KVE~f~  286 (422)
T PRK05431        215 DLFKIE--------DDDLYLIPTAEVPLTNLHRDEILDEEELPIKYTAYSPCFRSEAGSAGRDTRGLIRQHQFDKVELVK  286 (422)
T ss_pred             HHHHHC--------CCCEEEECCCCCCHHHHHHCCCCCHHHCCHHHEEECCHHHHCCCCCCCCCCCCEEEEEECEEEEEE
T ss_conf             754105--------887176056532123344011336543984452788365303133675567612443000034335


Q ss_pred             ECCHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             10537678878999999887665521332100014653112586035778999999999850212125667520555555
Q gi|254781004|r  394 FCTKEQMFNECLKIHNLIISIYKDFGFEKIMVKLSTRPEKRVGSDALWDDAENIMKGVLDTIKNSSQDRINTGVLLGEGA  473 (652)
Q Consensus       394 F~~~eq~~~e~~~~~~~~~~v~~~~g~~~~~~~ls~~~~~~~g~~~~~~~ae~~l~~~l~~~~~~~~~~~~~~~~~g~~a  473 (652)
T Consensus       287 ~~~pe~S~~~~e~~~~~~e~i~~~L~lpyrvv~~~sgdlg~~a~~~---------------------yDiE-~W~P~~~~  344 (422)
T PRK05431        287 FTKPEDSYAELEELTGNAEEILQKLELPYRVVLLCTGDMGFSAAKT---------------------YDLE-VWLPGQNT  344 (422)
T ss_pred             ECCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHH---------------------EEEE-EEECCCCC
T ss_conf             3586779999999999999999875985023567876557665654---------------------5457-87156685


Q ss_pred             CCCCCCCCCHHHHCCCCCCCCCCCHHHHCCCCCCCEEEEECCCEEEEEEEEECCCHHHHHHHHHHHHHH----C-CCCCC
Q ss_conf             455432110021103310012110111022346741673179721379964034103789999999973----8-70887
Q gi|254781004|r  474 FYGPKFEYILKDAIGRDWQCGTIQVDFNLPSRFNAFYVNSHSEKCHPVMIHRAVFGSIERFIGIMIENF----K-GNLPL  548 (652)
Q Consensus       474 fygpkid~~~~d~~gr~~~~~tiq~df~~p~~f~l~y~~~dg~~~~pvmihr~~~Gs~eR~ia~liE~~----~-g~~P~  548 (652)
T Consensus       345 y-------------~EvsS~Sn-c~d~Q-srRl~iry~~~~~~~~~~htlNgt~~-A~~R~l~ailEn~q~~dg~i~iP~  408 (422)
T PRK05431        345 Y-------------REISSCSN-CTDFQ-ARRANIRYRDEDGKPELVHTLNGSGL-AVGRTLVAILENYQQADGSVTIPE  408 (422)
T ss_pred             E-------------EEEEEECC-CCHHH-HHHCCCEEECCCCCEEEEEECCCCHH-HHHHHHHHHHHHCCCCCCCEECCH
T ss_conf             4-------------52400015-01488-75302655179998664043115121-887899999884648998884781


Q ss_pred             CCCCE
Q ss_conf             33780
Q gi|254781004|r  549 WLSPI  553 (652)
Q Consensus       549 wLAP~  553 (652)
T Consensus       409 ~L~~y  413 (422)
T PRK05431        409 VLRPY  413 (422)
T ss_pred             HHHHH
T ss_conf             31201