HHsearch alignment for GI: 254781004 and conserved domain: PRK09537

>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed.
Probab=98.41  E-value=2.8e-07  Score=70.04  Aligned_cols=102  Identities=20%  Similarity=0.390  Sum_probs=72.3

Q ss_pred             HHHHHHHHHHH-HHCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCCCHHHHHHHHHHCCCC
Q ss_conf             99999999988-76896385554324431000112100125554201001456777823774343125777765201222
Q gi|254781004|r  276 FQTLISYMRRK-IKDDYEEINTPQVLDQHLWQQSGHWDSYRANMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKS  354 (652)
Q Consensus       276 ~~~ie~~ir~~-~~~G~~eV~tP~l~~~~Lw~~SGh~~~y~~~mf~~~~~~~~~~~~~~~~LkPmncp~h~~i~~~~~~S  354 (652)
T Consensus       209 lgkler~it~ffvdrgfleikspilip~eyiermgi-d~d--~els----kQiFrvd~n~CLRPMLAPnLYnylrkL~R~  281 (420)
T PRK09537        209 LGKLERDITKFFVDRGFLEIKSPILIPAEYIERMGI-DND--TELS----KQIFRVDKNFCLRPMLAPNLYNYLRKLDRA  281 (420)
T ss_pred             HHHHHHHHHHHHHCCCCEEECCCEECCHHHHHHHCC-CCH--HHHH----HHHEEECCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             767788889985414513514850421999998578-860--5655----451674345332410142699999999861


Q ss_pred             HHHCCHHHHHHEEEECCCCCCCCEEEEECCCCCCC
Q ss_conf             23104320001000127876452000105635334
Q gi|254781004|r  355 YRELPVRLAEFGSVYRNEPSGSLHGLMRVRGFTQD  389 (652)
Q Consensus       355 YrdLPlrl~e~~~~~R~E~sg~l~GL~R~ReF~~~  389 (652)
T Consensus       282 lpd-PIrIFEIGpCyRKESdG~----~HLeEFTMl  311 (420)
T PRK09537        282 LPD-PIKIFEIGPCYRKESDGK----EHLEEFTMV  311 (420)
T ss_pred             CCC-CEEEEEECCCCCCCCCCH----HHHHHHHHH
T ss_conf             688-715886204303444106----788777777