HHsearch alignment for GI: 254781004 and conserved domain: PTZ00326

>PTZ00326 phenylalanyl-tRNA synthetase; Provisional.
Probab=96.60  E-value=0.02  Score=36.56  Aligned_cols=141  Identities=15%  Similarity=0.187  Sum_probs=81.5

Q ss_pred             HHHHHHHHHHHHHHH-HCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCCC-----------
Q ss_conf             899999999999887-68963855543244310001121001255542010014567778237743431-----------
Q gi|254781004|r  273 WKIFQTLISYMRRKI-KDDYEEINTPQVLDQHLWQQSGHWDSYRANMFAVKCADDTIKDLRTFALKPMN-----------  340 (652)
Q Consensus       273 ~~i~~~ie~~ir~~~-~~G~~eV~tP~l~~~~Lw~~SGh~~~y~~~mf~~~~~~~~~~~~~~~~LkPmn-----------  340 (652)
T Consensus       241 ~hp~~~~~~~~r~if~~mGF~E~~~~~~ves~fwNf--------DaLf~Pq~HPARd~~DTF~l~~p~~~~~~~~~~~~~  312 (505)
T PTZ00326        241 LHPLLKVRQEFREIFMEMGFEEMPTNRWVESSFWNF--------DALFIPQQHPARDLQDTFFLSKPETSKFLDAEYVER  312 (505)
T ss_pred             CCHHHHHHHHHHHHHHHCCCEECCCCCEEEECCCCC--------HHHCCCCCCCCCCCCCEEEECCCCCCCCCCHHHHHH
T ss_conf             688999999999999977976766897133132131--------110489899866523347744754245687899998


Q ss_pred             ---------------------------------HHHHH-HHHH---HCCCCHHHCCHHHHHHEEEECCCCCCCCEEEEEC
Q ss_conf             ---------------------------------25777-7652---0122223104320001000127876452000105
Q gi|254781004|r  341 ---------------------------------CPGHV-AVFN---HGLKSYRELPVRLAEFGSVYRNEPSGSLHGLMRV  383 (652)
Q Consensus       341 ---------------------------------cp~h~-~i~~---~~~~SYrdLPlrl~e~~~~~R~E~sg~l~GL~R~  383 (652)
T Consensus       313 Vk~vHe~G~~gs~Gw~y~W~~~~a~~~~LRthTt~vs~r~l~~~~~~~~~~~~~~P~k~fsi~rv~R~e~~d~----th~  388 (505)
T PTZ00326        313 VKAVHSGGGYGSIGWQYNWKLEEARKNVLRTHTTAVSARMLYKLAQQYQKGKGFKPKKYFSIDRVFRNETLDA----THL  388 (505)
T ss_pred             HHHHHCCCCCCCCCCCCCCCHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCEEEECCCEEECCCCCC----CCC
T ss_conf             8888506887888767787977875206365775376999998754046556889814752372641577776----534


Q ss_pred             CCCCCCCCEEECCHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCC
Q ss_conf             6353344210105376788789999998876655213321000146
Q gi|254781004|r  384 RGFTQDDAHVFCTKEQMFNECLKIHNLIISIYKDFGFEKIMVKLST  429 (652)
Q Consensus       384 ReF~~~Dah~F~~~eq~~~e~~~~~~~~~~v~~~~g~~~~~~~ls~  429 (652)
T Consensus       389 ~~f~Q~eg~~~~~----~~~~~~l~~~l~~f~~~~g~~~~rfrp~y  430 (505)
T PTZ00326        389 AEFHQVEGVVIDR----NLSLGDLMGTLREFFRRIGISKLRFKPAF  430 (505)
T ss_pred             CEEEEEEEEEECC----CCCHHHHHHHHHHHHHHHCCCCEEECCCC
T ss_conf             0455435789648----88899999999999998498757868888