HHsearch alignment for GI: 254781004 and conserved domain: pfam00587

>pfam00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T). Other tRNA synthetase sub-families are too dissimilar to be included. This domain is the core catalytic domain of tRNA synthetases and includes glycyl, histidyl, prolyl, seryl and threonyl tRNA synthetases.
Probab=100.00  E-value=2.6e-34  Score=256.64  Aligned_cols=162  Identities=33%  Similarity=0.574  Sum_probs=144.3

Q ss_pred             HHHHHHHHHHHHH-HCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCCCHHHHHHHHHHCCC
Q ss_conf             9999999999887-689638555432443100011210012555420100145677782377434312577776520122
Q gi|254781004|r  275 IFQTLISYMRRKI-KDDYEEINTPQVLDQHLWQQSGHWDSYRANMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLK  353 (652)
Q Consensus       275 i~~~ie~~ir~~~-~~G~~eV~tP~l~~~~Lw~~SGh~~~y~~~mf~~~~~~~~~~~~~~~~LkPmncp~h~~i~~~~~~  353 (652)
T Consensus         1 l~~~l~~~~~~~~~~~G~~~i~tP~l~~~~~~~~sg~~~~~~~~my~~~-----d~~~~~l~Lrp~~~~~~~~~~~~~~~   75 (170)
T pfam00587         1 LRNALENFIRDLFKRYGYQEVDTPILEPKELWEGSGHWDDYFDEMYRFK-----DRGGEELYLRPTAEVGITRLFKNEIL   75 (170)
T ss_pred             CHHHHHHHHHHHHHHCCCEEEECCEEEEHHHHHHCCCCCCCHHHEEEEE-----CCCCCEEEEECCCCHHHHHHHHHHCC
T ss_conf             9799999999999985998999991756789834477655753125673-----58997688732574588899886200


Q ss_pred             CHHHCCHHHHHHEEEECCCCCCCCEEEEECCCCCCCCCEEECCHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCC-
Q ss_conf             2231043200010001278764520001056353344210105376788789999998876655213321000146531-
Q gi|254781004|r  354 SYRELPVRLAEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMFNECLKIHNLIISIYKDFGFEKIMVKLSTRPE-  432 (652)
Q Consensus       354 SYrdLPlrl~e~~~~~R~E~sg~l~GL~R~ReF~~~Dah~F~~~eq~~~e~~~~~~~~~~v~~~~g~~~~~~~ls~~~~-  432 (652)
T Consensus        76 ~~~~lP~r~~~~~~~fR~E~~~-~~Gl~R~reF~q~d~~~~~~~e~s~~~~~e~~~~~~~~~~~lgl~-~~i~~~~~g~l  153 (170)
T pfam00587        76 SYRDLPLKLYQIGPCFRYEARP-RRGLGRVREFTQVDAEIFGTPEQSEEEDEELLKLAEEILQDLGLP-YRVVLNTRGDL  153 (170)
T ss_pred             CCCCCCCEEECCCCCCCCCCCC-CCCCCEEEEEEEECEEEEECCCHHHHHHHHHHHHHHHHHHHCCCC-EEEEECCCCCC
T ss_conf             3235860133065300677776-667743678898047999670042999999999999999987996-79997267778


Q ss_pred             ----CCCCCHHHHHH
Q ss_conf             ----12586035778
Q gi|254781004|r  433 ----KRVGSDALWDD  443 (652)
Q Consensus       433 ----~~~g~~~~~~~  443 (652)
T Consensus       154 ~~~~~~~~d~E~w~~  168 (170)
T pfam00587       154 GGYASKTGDLEAWLP  168 (170)
T ss_pred             CCHHHHCCCCCEECC
T ss_conf             986786078520578