HHsearch alignment for GI: 254781004 and conserved domain: smart00863

>smart00863 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain. The catalytically active form of threonyl/alanyl tRNA synthetase is a dimer. Within the tRNA synthetase class II dimer, the bound tRNA interacts with both monomers making specific interactions with the catalytic domain, the C-terminal domain, and this SAD domain (the second additional domain). The second additional domain is comprised of a pair of perpendicularly orientated antiparallel beta sheets, of four and three strands, respectively, that surround a central alpha helix that forms the core of the domain.
Probab=98.49  E-value=2.1e-08  Score=77.80  Aligned_cols=43  Identities=47%  Similarity=1.019  Sum_probs=39.5

Q ss_pred             CEEECCCCC-EEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEE
Q ss_conf             213025752-010002355214442223333332111015775642068999
Q gi|254781004|r  171 VTLYRQGEW-FDLCRGPHVRSTGQVKKFFKLMKVAGAYWRGDSNRPMLSRIY  221 (652)
Q Consensus       171 v~~y~~g~~-~Dlc~GphvpsTg~ik~~fkL~~~sgayw~gd~~~~~l~Riy  221 (652)
T Consensus         1 vrvv~i~~~~~~~C~GtHv~~T~~ig~-~ki~~~~~~~~~-------~~RI~   44 (44)
T smart00863        1 VRVVSIGDFDVELCGGTHVPNTGEIGA-FKILSVSGAYWG-------LQRIY   44 (44)
T ss_pred             CEEEEECCEEEECCCCCCCCCCCEEEE-EEEEEECHHCCC-------CEECC
T ss_conf             979999997987878966367062436-999995621328-------59249