RPSBLAST alignment for GI: 254781004 and conserved domain: PRK00413

>gnl|CDD|179011 PRK00413, thrS, threonyl-tRNA synthetase; Reviewed. Length = 638
 Score = 1085 bits (2808), Expect = 0.0
 Identities = 350/647 (54%), Positives = 466/647 (72%), Gaps = 14/647 (2%)

Query: 5   IKLTFPDGSIKNFPVHATGSDVAESISRSLAKKAVAVAINGKVCDLSDPVRE-GSIEIIT 63
           IK+T PDGS++ F    T +DVA SIS  LAK AVA  +NG++ DLS P+ E  S+EIIT
Sbjct: 2   IKITLPDGSVREFEAGVTVADVAASISPGLAKAAVAGKVNGELVDLSTPIEEDASLEIIT 61

Query: 64  PEDPRSLAVIRHSCAHIMAEAVQSIWPEVQVAIGPIIEDGFYYDFDKEQPFSSDELAQIE 123
            +D   L +IRHS AH++A+AV+ ++P+ ++ IGP+IE+GFYYDFD+E+PF+ ++L  IE
Sbjct: 62  AKDEEGLEIIRHSAAHLLAQAVKRLYPDAKLTIGPVIENGFYYDFDRERPFTPEDLEAIE 121

Query: 124 KKMQEIIARDSPFLKQYLSHEKARELFESKKEAYKVEILESIPAKENVTLYRQGEWFDLC 183
           K+M+EII  + P  ++ +S E+A ELF+ + E YKVE++E IP  E ++LYRQGE+ DLC
Sbjct: 122 KEMKEIIKENYPIEREVVSREEAIELFKDRGEPYKVELIEEIPEDEEISLYRQGEFVDLC 181

Query: 184 RGPHVRSTGQVKKFFKLMKVAGAYWRGDSNRPMLSRIYGTAWNTQQELTQYLYFLEESEK 243
           RGPHV STG++K  FKL+KVAGAYWRGDS   ML RIYGTA+  ++EL  YL+ LEE++K
Sbjct: 182 RGPHVPSTGKIK-AFKLLKVAGAYWRGDSKNKMLQRIYGTAFADKKELDAYLHRLEEAKK 240

Query: 244 RDHRKLAREMDLFHIAEDGSGVIFWHRKGWKIFQTLISYMRRK-IKDDYEEINTPQVLDQ 302
           RDHRKL +E+DLFH  E+  G+ FWH KGW I + L  Y+RRK  K  Y+E+ TPQ+LD+
Sbjct: 241 RDHRKLGKELDLFHFQEEAPGLPFWHPKGWTIRRELERYIRRKLRKAGYQEVKTPQILDR 300

Query: 303 HLWQQSGHWDSYRANMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRL 362
            LW+ SGHWD YR NMF    +D        +ALKPMNCPGHV ++  GL+SYR+LP+RL
Sbjct: 301 ELWETSGHWDHYRENMFPTTESDG-----EEYALKPMNCPGHVQIYKQGLRSYRDLPLRL 355

Query: 363 AEFGSVYRNEPSGSLHGLMRVRGFTQDDAHVFCTKEQMFNECLKIHNLIISIYKDFGFEK 422
           AEFG+V+R EPSG+LHGLMRVRGFTQDDAH+FCT EQ+  E  K+ +LI+ +YKDFGFE 
Sbjct: 356 AEFGTVHRYEPSGALHGLMRVRGFTQDDAHIFCTPEQIEEEVKKVIDLILDVYKDFGFED 415

Query: 423 IMVKLSTRPEKRVGSDALWDDAENIMKGVLDTIKNSSQDRINTGVLLGEGAFYGPKFEYI 482
             VKLSTRPEKR+GSD +WD AE  +K  LD +       ++  +  GEGAFYGPK ++ 
Sbjct: 416 YEVKLSTRPEKRIGSDEMWDKAEAALKEALDELG------LDYEIAPGEGAFYGPKIDFQ 469

Query: 483 LKDAIGRDWQCGTIQVDFNLPSRFNAFYVNSHSEKCHPVMIHRAVFGSIERFIGIMIENF 542
           LKDA+GR+WQCGTIQ+DFNLP RF+  YV    EK  PVMIHRA+ GS+ERFIGI+IE++
Sbjct: 470 LKDALGREWQCGTIQLDFNLPERFDLTYVGEDGEKHRPVMIHRAILGSMERFIGILIEHY 529

Query: 543 KGNLPLWLSPIQAIVTTITSSAVEYAQEIANLLKSHHLSIETDFRNETINYKIREHSIKK 602
            G  P WL+P+Q +V  IT    +YA+E+A  LK+  + +E D RNE I YKIRE  ++K
Sbjct: 530 AGAFPTWLAPVQVVVLPITDKHADYAKEVAKKLKAAGIRVEVDLRNEKIGYKIREAQLQK 589

Query: 603 IPIIIICGDKEASERSIGIRRFGSTTTQKVSLLDAIPILTKESLPPD 649
           +P +++ GDKE    ++ +RR G      +SL + I  L +E     
Sbjct: 590 VPYMLVVGDKEVEAGTVSVRRRGGKDLGTMSLDEFIERLLEEIASRS 636