RPSBLAST alignment for GI: 254781004 and conserved domain: PRK01584

>gnl|CDD|179306 PRK01584, PRK01584, alanyl-tRNA synthetase; Provisional. Length = 594
 Score = 52.1 bits (125), Expect = 5e-07
 Identities = 32/130 (24%), Positives = 60/130 (46%), Gaps = 20/130 (15%)

Query: 75  HSCAHIMAEAVQSIWPE-VQVAIGPIIEDGFYYDFDKEQPFSSDELAQIEKKMQEIIARD 133
           H+  H++ +A++ +  + V+     I  +   +DF   +  + DE+ ++E  +   I  D
Sbjct: 457 HTATHLLHKALRLVLGDHVRQKGSNITAERLRFDFSHPEKMTDDEIKKVEDIVNLQIKND 516

Query: 134 SPFLKQYLSHEKARE-----LFESKKEAYKVEILESIPAKENVTLYRQGEW-FDLCRGPH 187
               K+ +S E+ARE     LF  K E             + V +Y    +  ++C GPH
Sbjct: 517 LSVKKEVMSLEEAREKGAMALFGEKYE-------------DIVKVYEIDGFSKEVCGGPH 563

Query: 188 VRSTGQVKKF 197
           V +TG++  F
Sbjct: 564 VENTGELGTF 573