RPSBLAST alignment for GI: 254781004 and conserved domain: COG2872

>gnl|CDD|32699 COG2872, COG2872, Predicted metal-dependent hydrolases related to alanyl-tRNA synthetase HxxxH domain [General function prediction only]. Length = 241
 Score = 47.3 bits (112), Expect = 1e-05
 Identities = 29/140 (20%), Positives = 56/140 (40%), Gaps = 12/140 (8%)

Query: 74  RHSCAHIMAEAVQSIWPEVQVAIGPIIEDGFYYDFDKEQPFSSDELAQIEKKMQEIIARD 133
            H+  H+++  +  ++         I ED    DFD     + DE+ ++E    E++  +
Sbjct: 98  MHTALHLLSAVLYKVYG-ALTTGFEIGEDYARIDFD--GEDTEDEIEEVEALANELVKEN 154

Query: 134 SPFLKQYLSHEKARELFESKKEAYKVEILESIPAKENVTLYRQGEWFDL--CRGPHVRST 191
            P +  ++  E+A +L    K        +  P  E      +    D+  C G HV++T
Sbjct: 155 LPVIIYFIPREEAEKLPGLVKLK-----NKVPPDVEGKIRIVEIGDIDVQPCGGTHVKNT 209

Query: 192 GQVKKFF--KLMKVAGAYWR 209
           G++ +    K  K      R
Sbjct: 210 GEIGEIKILKTEKKGKGNRR 229