RPSBLAST alignment for GI: 254781004 and conserved domain: KOG0188

>gnl|CDD|35409 KOG0188, KOG0188, KOG0188, Alanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 895
 Score = 46.1 bits (109), Expect = 3e-05
 Identities = 29/159 (18%), Positives = 66/159 (41%), Gaps = 18/159 (11%)

Query: 47  VCDLSDPVREG-SIEIITPEDPRSLAVIRHSCAHIMAEAVQSIWPEVQVAIGPIIEDGFY 105
           +  L   +  G  +E+   E+ R L +  H+  H++  A++ +          +  D   
Sbjct: 542 IGVLEGDLSVGDQVELHVDEERRQLIMRNHTATHLLNFALRQVLKGTDQKGSLVAPDKLR 601

Query: 106 YDFDKEQPFSSDELAQIEKKMQEIIARDSPFLKQYLSHEKARELFESKKEAYKVEILESI 165
           +DF  +   + ++L ++E K+ E I +++P   + L   +A+          K+  L ++
Sbjct: 602 FDFSTKGALTKEQLKKVEDKINEFIQKNAPVYAKELPLAEAK----------KIPGLRAV 651

Query: 166 PAK---ENVTLYRQGEW----FDLCRGPHVRSTGQVKKF 197
             +   + V +   G       + C G H+ +T  +  F
Sbjct: 652 FDEVYPDPVRVVSVGAGQLTSVEFCGGTHLTNTSHIGDF 690