BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781005|ref|YP_003065418.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781005|ref|YP_003065418.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62] gi|254040682|gb|ACT57478.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 161 bits (408), Expect = 2e-38, Method: Composition-based stats. Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 1 MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQERKKADQPIGGGKTGETLPK 60 MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQERKKADQPIGGGKTGETLPK Sbjct: 1 MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQERKKADQPIGGGKTGETLPK 60 Query: 61 GGGRKISLDSNNLSTELRSQNFLRK 85 GGGRKISLDSNNLSTELRSQNFLRK Sbjct: 61 GGGRKISLDSNNLSTELRSQNFLRK 85 >gi|254780886|ref|YP_003065299.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter asiaticus str. psy62] gi|254040563|gb|ACT57359.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter asiaticus str. psy62] Length = 41 Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 20/41 (48%), Positives = 31/41 (75%) Query: 1 MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQE 41 M+ KGLIVAS+ISST IMS CS + + ++ IR++ +K++ Sbjct: 1 MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41 >gi|172038315|ref|YP_001804816.1| putative sulfite oxidase subunit YedY [Cyanothece sp. ATCC 51142] gi|171699769|gb|ACB52750.1| unknown [Cyanothece sp. ATCC 51142] Length = 327 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 10/84 (11%) Query: 3 IKGLIVASLISSTVIMSGCSETLDP---ENGIRE---LGARMKQERKKADQP----IGGG 52 +KG+I AS+ SS + +SGC ++ E +++ G + E + D+P I G Sbjct: 30 LKGMIGASIASSLIPLSGCQKSASQTALEATLQKPKIPGVKTSPEFSQVDRPMTKEILAG 89 Query: 53 KTGETLPKGGGRKISLDSNNLSTE 76 + GG +KI L++ NL TE Sbjct: 90 QYNNFYEFGGNKKIWLNAQNLPTE 113 >gi|67925647|ref|ZP_00518967.1| Oxidoreductase, molybdopterin binding [Crocosphaera watsonii WH 8501] gi|67852508|gb|EAM47947.1| Oxidoreductase, molybdopterin binding [Crocosphaera watsonii WH 8501] Length = 327 Score = 35.8 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 10/84 (11%) Query: 3 IKGLIVASLISSTVIMSGCSETLDPE------NGIRELGARMKQERKKADQP----IGGG 52 +KG+I AS+ S + +SGC ++ G + G + + + D+P I G Sbjct: 30 LKGIIGASIAGSLIPLSGCQKSASQTALEATLQGTKIPGVKTSPKFSQVDRPMTKEILAG 89 Query: 53 KTGETLPKGGGRKISLDSNNLSTE 76 + GG +KI L++ NL TE Sbjct: 90 QYNNFYEFGGTKKIWLNAQNLPTE 113 >gi|251793774|ref|YP_003008504.1| lipoprotein VacJ [Aggregatibacter aphrophilus NJ8700] gi|247535171|gb|ACS98417.1| lipoprotein VacJ [Aggregatibacter aphrophilus NJ8700] Length = 258 Score = 35.4 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 22/27 (81%) Query: 7 IVASLISSTVIMSGCSETLDPENGIRE 33 ++A+L+ +V+++GCS T+DPE G R+ Sbjct: 17 LLAALLLGSVVLTGCSSTIDPETGERK 43 >gi|261866860|ref|YP_003254782.1| lipoprotein VacJ [Aggregatibacter actinomycetemcomitans D11S-1] gi|293391047|ref|ZP_06635381.1| lipoprotein VacJ [Aggregatibacter actinomycetemcomitans D7S-1] gi|261412192|gb|ACX81563.1| lipoprotein VacJ [Aggregatibacter actinomycetemcomitans D11S-1] gi|290951581|gb|EFE01700.1| lipoprotein VacJ [Aggregatibacter actinomycetemcomitans D7S-1] Length = 258 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 22/27 (81%) Query: 7 IVASLISSTVIMSGCSETLDPENGIRE 33 ++A+L+ +V+++GCS T+DPE G R+ Sbjct: 17 LLAALLLGSVVLAGCSSTIDPETGERK 43 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.311 0.132 0.358 Lambda K H 0.267 0.0407 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 705,545,324 Number of Sequences: 14124377 Number of extensions: 24340140 Number of successful extensions: 46614 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 46610 Number of HSP's gapped (non-prelim): 6 length of query: 85 length of database: 4,842,793,630 effective HSP length: 55 effective length of query: 30 effective length of database: 4,065,952,895 effective search space: 121978586850 effective search space used: 121978586850 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 75 (33.5 bits)