RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254781005|ref|YP_003065418.1| hypothetical protein
CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62]
         (85 letters)



>gnl|CDD|182518 PRK10525, PRK10525, cytochrome o ubiquinol oxidase subunit II;
          Provisional.
          Length = 315

 Score = 27.1 bits (60), Expect = 0.95
 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 3  IKGLIVASLISSTVIMSGCSETL-DPENGI 31
           K L   SL + TV++SGC+  L DP+  I
Sbjct: 7  NKSLGWLSLFAGTVLLSGCNSALLDPKGQI 36


>gnl|CDD|184283 PRK13731, PRK13731, conjugal transfer surface exclusion protein
          TraT; Provisional.
          Length = 243

 Score = 25.0 bits (54), Expect = 4.0
 Identities = 10/22 (45%), Positives = 16/22 (72%)

Query: 1  MDIKGLIVASLISSTVIMSGCS 22
          M  K L++ +L+SST+ +SGC 
Sbjct: 1  MKTKKLMMVALVSSTLALSGCG 22


>gnl|CDD|179508 PRK02944, PRK02944, OxaA-like protein precursor; Validated.
          Length = 255

 Score = 25.1 bits (55), Expect = 4.2
 Identities = 9/27 (33%), Positives = 16/27 (59%)

Query: 1  MDIKGLIVASLISSTVIMSGCSETLDP 27
          M  K  ++A +++   I++GCSE   P
Sbjct: 1  MKKKLGLLAMVVALMAILAGCSEVNQP 27


>gnl|CDD|130853 TIGR01793, cit_synth_euk, citrate (Si)-synthase, eukaryotic.
          This model includes both mitochondrial and peroxisomal
          forms of citrate synthase. Citrate synthase is the
          entry point to the TCA cycle from acetyl-CoA.
          Peroxisomal forms, such as SP:P08679 from yeast
          (recognized by the C-terminal targeting motif SKL) act
          in the glyoxylate cycle. Eukaryotic homologs excluded
          by the high trusted cutoff of this model include a
          Tetrahymena thermophila citrate synthase that doubles
          as a filament protein, a putative citrate synthase from
          Plasmodium falciparum (no TCA cycle), and a
          methylcitrate synthase from Aspergillus nidulans.
          Length = 427

 Score = 24.9 bits (54), Expect = 4.7
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query: 25 LDPENGIRELGARMKQERKKADQPIGGGKTGETLPKG 61
          LDPE GIR  G  + + +K   +  GG    E LP+G
Sbjct: 56 LDPEEGIRFRGLSIPECQKLLPKAKGG---EEPLPEG 89


>gnl|CDD|181615 PRK09028, PRK09028, cystathionine beta-lyase; Provisional.
          Length = 394

 Score = 24.7 bits (54), Expect = 5.1
 Identities = 8/16 (50%), Positives = 10/16 (62%)

Query: 30  GIRELGARMKQERKKA 45
           G+R LG R+ Q  K A
Sbjct: 252 GLRTLGVRLAQHEKNA 267


>gnl|CDD|181567 PRK08861, PRK08861, cystathionine gamma-synthase; Provisional.
          Length = 388

 Score = 23.7 bits (51), Expect = 9.8
 Identities = 10/18 (55%), Positives = 12/18 (66%)

Query: 30  GIRELGARMKQERKKADQ 47
           GIR LGARM+   + A Q
Sbjct: 245 GIRTLGARMRVHEESAQQ 262


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.311    0.132    0.358 

Gapped
Lambda     K      H
   0.267   0.0816    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 1,304,885
Number of extensions: 68498
Number of successful extensions: 99
Number of sequences better than 10.0: 1
Number of HSP's gapped: 99
Number of HSP's successfully gapped: 15
Length of query: 85
Length of database: 5,994,473
Length adjustment: 54
Effective length of query: 31
Effective length of database: 4,827,641
Effective search space: 149656871
Effective search space used: 149656871
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 50 (22.9 bits)