RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254781005|ref|YP_003065418.1| hypothetical protein
CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62]
         (85 letters)



>1ooy_A Succinyl-COA:3-ketoacid-coenzyme A transferase,
          mitochondrial precursor; alpha/beta protein; 1.70A {Sus
          scrofa} (A:1-248)
          Length = 248

 Score = 24.8 bits (53), Expect = 4.5
 Identities = 15/76 (19%), Positives = 23/76 (30%), Gaps = 4/76 (5%)

Query: 9  ASLISS--TVIMSGCSETLDPENGIRELGARMKQERKKADQPIGGGKTGET--LPKGGGR 64
             I +  TV++ G      PEN I  L     +E        G    G    L     +
Sbjct: 11 VKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDNFGLGLLLQSKQIK 70

Query: 65 KISLDSNNLSTELRSQ 80
          ++       + E   Q
Sbjct: 71 RMISSYVGENAEFERQ 86


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.311    0.132    0.358 

Gapped
Lambda     K      H
   0.267   0.0481    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 584,734
Number of extensions: 21865
Number of successful extensions: 52
Number of sequences better than 10.0: 1
Number of HSP's gapped: 52
Number of HSP's successfully gapped: 1
Length of query: 85
Length of database: 4,956,049
Length adjustment: 48
Effective length of query: 37
Effective length of database: 3,333,409
Effective search space: 123336133
Effective search space used: 123336133
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 50 (23.6 bits)