BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254781005|ref|YP_003065418.1| hypothetical protein
CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62]
         (85 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254781005|ref|YP_003065418.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 85

 Score =  169 bits (428), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 85/85 (100%), Positives = 85/85 (100%)

Query: 1  MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQERKKADQPIGGGKTGETLPK 60
          MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQERKKADQPIGGGKTGETLPK
Sbjct: 1  MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQERKKADQPIGGGKTGETLPK 60

Query: 61 GGGRKISLDSNNLSTELRSQNFLRK 85
          GGGRKISLDSNNLSTELRSQNFLRK
Sbjct: 61 GGGRKISLDSNNLSTELRSQNFLRK 85


>gi|254780886|ref|YP_003065299.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 41

 Score = 44.7 bits (104), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 31/41 (75%)

Query: 1  MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQE 41
          M+ KGLIVAS+ISST IMS CS + + ++ IR++   +K++
Sbjct: 1  MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41


>537021.9.peg.60_1 
          Length = 44

 Score = 28.5 bits (62), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 18/21 (85%)

Query: 1  MDIKGLIVASLISSTVIMSGC 21
          ++IK L++ SL+SST I+SGC
Sbjct: 15 VNIKKLLIVSLLSSTAIISGC 35


>gi|254780828|ref|YP_003065241.1| ATP-dependent protease peptidase subunit [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 190

 Score = 26.6 bits (57), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 9/35 (25%), Positives = 25/35 (71%)

Query: 2   DIKGLIVASLISSTVIMSGCSETLDPENGIRELGA 36
           +++ +I+ +  + T++++G  + L+PENG+  +G+
Sbjct: 105 NLEAMILIADKTITLVITGMGDVLEPENGVMAIGS 139


>gi|254780768|ref|YP_003065181.1| hypothetical protein CLIBASIA_03295 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 281

 Score = 22.3 bits (46), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 40  QERKKADQPIGGGKTGETLPKGGGRKISLDS 70
           Q+  +AD P  G KT + + K G   I+L++
Sbjct: 220 QQDMRADLPSIGAKTVQNVIKAGLAGIALEA 250


>gi|254780935|ref|YP_003065348.1| rare lipoprotein A [Candidatus Liberibacter asiaticus str. psy62]
          Length = 276

 Score = 20.8 bits (42), Expect = 4.7,   Method: Composition-based stats.
 Identities = 6/11 (54%), Positives = 10/11 (90%)

Query: 54 TGETLPKGGGR 64
          +G+ +P+GGGR
Sbjct: 54 SGKRVPRGGGR 64


>gi|254780631|ref|YP_003065044.1| hypothetical protein CLIBASIA_02590 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 62

 Score = 20.4 bits (41), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query: 18 MSGCSETLDPEN--GIR-ELGARMKQERKKADQPIGG 51
          MSGCS+ +D E+  GI  E  A   ++ +K   P  G
Sbjct: 1  MSGCSDNIDREHKAGIEVEKNAITTKDNEKKRNPFQG 37


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.311    0.132    0.358 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 49,942
Number of Sequences: 1233
Number of extensions: 1723
Number of successful extensions: 8
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of query: 85
length of database: 328,796
effective HSP length: 54
effective length of query: 31
effective length of database: 262,214
effective search space:  8128634
effective search space used:  8128634
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (20.8 bits)
S2: 31 (16.5 bits)