Query         gi|254781007|ref|YP_003065420.1| hypothetical protein CLIBASIA_04540 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 411
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 33803
Date          Wed Jun  1 21:00:55 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781007.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2ww8_A RRGA, cell WALL surfac  95.8   0.018 5.2E-07   37.3   5.2   59  326-393   202-267 (269)
  2 >2yy8_A ATRM56, UPF0106 protei  49.4      17 0.00049   16.3   3.6   62  346-411     2-68  (201)
  3 >1x9d_A Endoplasmic reticulum   42.1     6.2 0.00018   19.3   0.0   64  295-367   155-228 (305)
  4 >1pp9_C Cytochrome B; cytochro  39.9     4.9 0.00014   20.0  -0.8   55  206-278    33-87  (101)
  5 >3cx5_C Cytochrome B-C1 comple  36.2     7.2 0.00021   18.8  -0.4   53  205-275    33-85  (106)
  6 >3kp1_E D-ornithine aminomutas  32.0      13 0.00039   17.0   0.3   38   34-78     20-57  (76)
  7 >2ri9_A Mannosyl-oligosacchari  26.3      15 0.00044   16.6  -0.2   78  285-375    19-98  (100)
  8 >3kmp_A SMAD1-MH1; protein-DNA  25.0      19 0.00057   15.8   0.2   15  220-234    94-108 (110)
  9 >2jhn_A ALKA, 3-methyladenine   25.0      40  0.0012   13.6   2.3   32   51-82      7-38  (61)
 10 >2v6z_M DNA polymerase epsilon  23.3      40  0.0012   13.5   1.6   18  315-332    81-98  (99)
 11 >3imo_A Integron cassette prot  23.2      43  0.0013   13.4   2.1   34  361-395    29-62  (133)
 12 >2qjy_A Cytochrome B; cytochro  23.1      18 0.00053   16.0  -0.3   50  207-274    35-84  (104)
 13 >2odp_A Complement C2; C3/C5 c  22.1      45  0.0013   13.2   2.6   54  339-392   156-212 (224)

No 1  
>>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} (A:221-279,A:318-447,A:506-585)
Probab=95.83  E-value=0.018  Score=37.26  Aligned_cols=59  Identities=19%  Similarity=0.300  Sum_probs=41.7

Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCC-------HHHHHHHHCCCCHHEEEECCCCCHHHHHHHHHHHH
Q ss_conf             999998599887511476416899740488742-------02678763059032044258765344789877777
Q gi|254781007|r  326 EKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQD-------TRYTLRQCASDPSKYYEINSDENVMPIAKSLARNV  393 (411)
Q Consensus       326 ekvlqdchymhkrhrtgrdaitifsvgfspdqd-------trytlrqcasdpskyyeinsdenvmpiakslarnv  393 (411)
                      ...+..|-.+..      ..|+||+|||..+-+       .++-|+.|||+|+.||+...   .-.+-+++|+..
T Consensus       202 ~~~~~~c~~~k~------~~i~i~ti~~~~~~~~~~~~~~~~~~l~~cas~~~~y~~~~~---~~~~f~~ia~~~  267 (269)
T 2ww8_A          202 PTRWYYNGNIAP------DGYDVFTVGIGINGDPGTDEATATSFMQSISSKPENYTNVTD---TTKILEQLNRYF  267 (269)
T ss_dssp             HHHHHHHHHTGG------GCCEEEEEEESCCCTTTSCHHHHHHHHHHTSSSGGGEEEESS---GGGHHHHHHHHH
T ss_pred             CEEEEEEEECCC------CCCEEEEEEEECCCCCCCCCCCCCEEEEEEECCCCCEEEECC---CCCEECCCCCCC
T ss_conf             305788752046------763035776771564210023430577566116653264056---651111335541


No 2  
>>2yy8_A ATRM56, UPF0106 protein PH0461; DEEP trefoil knot, structural genomics, NPPSFA; HET: SAM MTA; 2.48A {Pyrococcus horikoshii} (A:)
Probab=49.42  E-value=17  Score=16.26  Aligned_cols=62  Identities=26%  Similarity=0.487  Sum_probs=42.4

Q ss_pred             EEEEEEECCCCCCHHHHHHHH----CCCCHHEEEE-CCCCCHHHHHHHHHHHHHHHHHHHEEEEEEECCCC
Q ss_conf             689974048874202678763----0590320442-58765344789877777874443325741301159
Q gi|254781007|r  346 ITIFSVGFSPDQDTRYTLRQC----ASDPSKYYEI-NSDENVMPIAKSLARNVITNWFSQFTITVVDSWRR  411 (411)
Q Consensus       346 itifsvgfspdqdtrytlrqc----asdpskyyei-nsdenvmpiakslarnvitnwfsqftitvvdswrr  411 (411)
                      |++.-.|--|.+|.|-|-.-|    |-..++.+-- +.|+.++    .-.+.|..+|=..|.|...++|++
T Consensus         2 I~VLRlGHRpeRDkRiTTHV~LtARAfGA~~iil~~e~D~~v~----esv~dV~~rwGG~F~ie~~~~w~~   68 (201)
T 2yy8_A            2 IVVLRLGHRPERDKRVTTHVALTARAFGADGIIIASEEDEKVK----ESVEDVVKRWGGPFFIEFNRNWRK   68 (201)
T ss_dssp             EEEEECCCCCC-CTHHHHHHHHHHHHTTCSEEEESSSCCHHHH----HHHHHHHHHHCSCCBCCBCSCHHH
T ss_pred             EEEEECCCCCCCCCCHHHHHHHHHHHHCCCEEEECCCCCCHHH----HHHHHHHHHCCCCEEEEECCCHHH
T ss_conf             7899657887667632458889998726875897478772588----899999985199669997458899


No 3  
>>1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} (A:1-125,A:337-516)
Probab=42.14  E-value=6.2  Score=19.29  Aligned_cols=64  Identities=25%  Similarity=0.430  Sum_probs=39.3

Q ss_pred             CCCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCC----------CCCHHHHHH
Q ss_conf             3446766770799997345100333028999999998599887511476416899740488----------742026787
Q gi|254781007|r  295 CFPHGASQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSP----------DQDTRYTLR  364 (411)
Q Consensus       295 cfphgasqnkymlmlaignqlsrssvekekiekvlqdchymhkrhrtgrdaitifsvgfsp----------dqdtrytlr  364 (411)
                      ||--|        |+|+|.++....-.-+--++....|+.+-++..||--. .+|+....+          ..|.+|-||
T Consensus       155 cF~gG--------~~aLg~~~~~~~~~l~~a~~l~~~c~~~y~~~~tGl~P-E~~~~~~~~~~~~~~~~~~~~~~~y~LR  225 (305)
T 1x9d_A          155 CFLPG--------TLALGVYHGLPASHMELAQELMETCYQMNRQMETGLSP-EIVHFNLYPQPGRRDVEVKPADRHNLLR  225 (305)
T ss_dssp             GHHHH--------HHHHHHHTTCCHHHHHHHHHHHHHHHHHHHTSTTSCCC-SEEECCSSCCTTCCSCBCCGGGCCBCCC
T ss_pred             HHHHH--------HHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCC-EEEEECCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             87677--------88760124787679999999999999988624167986-5665346687555666557345577889


Q ss_pred             HHC
Q ss_conf             630
Q gi|254781007|r  365 QCA  367 (411)
Q Consensus       365 qca  367 (411)
                      --+
T Consensus       226 PE~  228 (305)
T 1x9d_A          226 PET  228 (305)
T ss_dssp             CHH
T ss_pred             CHH
T ss_conf             229


No 4  
>>1pp9_C Cytochrome B; cytochrome BC1, membrane protein, heme protein, rieske iron sulfur protein, cytochrome B; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} (C:108-208)
Probab=39.95  E-value=4.9  Score=20.03  Aligned_cols=55  Identities=36%  Similarity=0.582  Sum_probs=39.5

Q ss_pred             HCHHHHHHHHHHHCCCCCEECCCCHHHHHHHEEEEEEEEEECCCCCHHHHHCCCCCCCHHCCHHHHHHHHHHH
Q ss_conf             0522578988761874320027202344341221125786258621256541864211000608999888741
Q gi|254781007|r  206 LNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVGTLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDM  278 (411)
Q Consensus       206 lnrntlvknflsqipyknfcmapyhyssilywavgtltysvdnktttreyykdpyyatwdhfpysfiknvfdm  278 (411)
                      .=..|...|.||.|||-.        ..+..|.-|.  +||||.|-||-+-        -||-..||---..|
T Consensus        33 FWGAtVITNLlSAiPYiG--------~~lV~WiWGG--fsvdnaTLtRFF~--------fHF~lPFii~~~~~   87 (101)
T 1pp9_C           33 FWGATVITNLLSAIPYIG--------TNLVEWIWGG--FSVDKATLTRFFA--------FHFILPFIIMAIAM   87 (101)
T ss_dssp             HHHHHHHHGGGGGSTTTH--------HHHHHHHHTS--SSSCHHHHHHHHH--------HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCC--------CCHHHHEECC--CCCCCCHHHHHHH--------HHHHHHHHHHHHHH
T ss_conf             889999999898756587--------5423010357--5787412778999--------99999999999999


No 5  
>>3cx5_C Cytochrome B-C1 complex subunit 8; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} (C:108-213)
Probab=36.22  E-value=7.2  Score=18.84  Aligned_cols=53  Identities=30%  Similarity=0.491  Sum_probs=38.8

Q ss_pred             HHCHHHHHHHHHHHCCCCCEECCCCHHHHHHHEEEEEEEEEECCCCCHHHHHCCCCCCCHHCCHHHHHHHH
Q ss_conf             70522578988761874320027202344341221125786258621256541864211000608999888
Q gi|254781007|r  205 YLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVGTLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNV  275 (411)
Q Consensus       205 ylnrntlvknflsqipyknfcmapyhyssilywavgtltysvdnktttreyykdpyyatwdhfpysfiknv  275 (411)
                      -.=..|...|++|.|||..        .+|..|.-|-  +||||.|-+|-|-        -||-..|+--.
T Consensus        33 SfWgATVITNL~SaiP~iG--------~~iV~wlWGG--fsV~n~TL~RFfs--------lHfllPFii~~   85 (106)
T 3cx5_C           33 SHWGATVITNLFSAIPFVG--------NDIVSWLWGG--FSVSNPTIQRFFA--------LHYLVPFIIAA   85 (106)
T ss_dssp             HHHHHHHHHHGGGGSTTTH--------HHHHHHHHTS--SSSCHHHHHHHHH--------HHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHCCCCC--------CCCHHHHCCC--CCCCCCHHHHHHH--------HHHHHHHHHHH
T ss_conf             2249999998998728273--------0019886188--7789614759999--------99998999999


No 6  
>>3kp1_E D-ornithine aminomutase S component; 5 aminomutase (OAM); HET: PLP B12 5AD; 2.01A {Clostridium sticklandii} PDB: 3kow_E* 3koy_E* 3koz_E* 3kp0_E* 3kox_E* (E:46-121)
Probab=31.98  E-value=13  Score=17.01  Aligned_cols=38  Identities=37%  Similarity=0.575  Sum_probs=29.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCHH
Q ss_conf             999999876677776667899998776520683323667741223
Q gi|254781007|r   34 VAIVDVVVDQVTVMQKTAWLQEVLDHVIYRTSPKNLYDLREAGRD   78 (411)
Q Consensus        34 vaivdvvvdqvtvmqktawlqevldhviyrtspknlydlreagrd   78 (411)
                      -+||+-|++. -.|-|-|      .|+.||-+.+.--|.||||+.
T Consensus        20 k~iVe~v~~~-gLlgKGA------GhvV~kiak~~~i~i~eAG~~   57 (76)
T 3kp1_E           20 KAIVDKTMDR-GLMGKGA------GHIVYKIAKEKNISVREAGLA   57 (76)
T ss_dssp             HHHHHHHHHT-TCGGGCH------HHHHHHHHHHTTCCHHHHHHH
T ss_pred             HHHHHHHHHH-CCCCCCC------CHHHHHHHHHCCCCHHHHHHH
T ss_conf             9999999980-5445775------532235797629988999999


No 7  
>>2ri9_A Mannosyl-oligosaccharide alpha-1,2-mannosidase; alternative conformations, modulation of activity, glycoprotein, glycosidase, hydrolase; HET: NAG NDG MAN MMA; 1.95A {Penicillium citrinum} (A:267-366)
Probab=26.26  E-value=15  Score=16.61  Aligned_cols=78  Identities=13%  Similarity=0.211  Sum_probs=49.9

Q ss_pred             CCEEEECCCC--CCCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCHHHH
Q ss_conf             8426413674--34467667707999973451003330289999999985998875114764168997404887420267
Q gi|254781007|r  285 DGQVLTNTNH--CFPHGASQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTRYT  362 (411)
Q Consensus       285 dgqvltntnh--cfphgasqnkymlmlaignqlsrssvekekiekvlqdchymhkrhrtgrdaitifsvgfspdqdtryt  362 (411)
                      +|..-....|  ||--|        |+|+|-.+....-.-+--+++...|+.|..+-.||--.- ||  .|.|+++..  
T Consensus        19 ~~~~~p~~~HL~CF~gG--------m~aLGa~~~~~~~~l~~a~~Lt~tC~~~Y~~t~TGl~PE-~~--~f~~~~~~~--   85 (100)
T 2ri9_A           19 NRNYDLSSQHLTCFDGG--------SFLLGGTVLDRQDFIDFGLELVDGCEATYNSTLTKIGPD-SW--GWDPKKVPS--   85 (100)
T ss_dssp             TTEEECEEETGGGGHHH--------HHHHHHHHHTCHHHHHHHHHHHHHHHHHHHTSSSSCCCS-EE--ECCTTCCCG--
T ss_pred             CCCCCCCCCHHHHHHCH--------HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-EE--CCCCCCCCC--
T ss_conf             88777640058675042--------666266233507789989999999999999747624784-21--466545677--


Q ss_pred             HHHHCCCCHHEEE
Q ss_conf             8763059032044
Q gi|254781007|r  363 LRQCASDPSKYYE  375 (411)
Q Consensus       363 lrqcasdpskyye  375 (411)
                      ...|--++..||-
T Consensus        86 ~~~~~~~~~~~yi   98 (100)
T 2ri9_A           86 DQKEFYEKAGFYI   98 (100)
T ss_dssp             GGHHHHHHHSCEE
T ss_pred             CCCHHCCCCCCEE
T ss_conf             5200034677154


No 8  
>>3kmp_A SMAD1-MH1; protein-DNA complex, SMAD1, SBE DNA, MH1 domain, beta hairpin, nucleus, transcription; 2.70A {Mus musculus} (A:15-124)
Probab=25.01  E-value=19  Score=15.80  Aligned_cols=15  Identities=40%  Similarity=1.061  Sum_probs=11.5

Q ss_pred             CCCCEECCCCHHHHH
Q ss_conf             743200272023443
Q gi|254781007|r  220 PYKNFCMAPYHYSSI  234 (411)
Q Consensus       220 pyknfcmapyhyssi  234 (411)
                      .....|.-|||||-|
T Consensus        94 ~~~~VC~NPyHy~Rv  108 (110)
T 3kmp_A           94 KQKEVCINPYHYKRV  108 (110)
T ss_dssp             CCSEEECCGGGEEEC
T ss_pred             CCCEEEECCCCHHHC
T ss_conf             998088487217540


No 9  
>>2jhn_A ALKA, 3-methyladenine DNA-glycosylase; DNA repair, N1-methyladenine, N3-methylcytosine, hyperthermophiles, hydrolase; HET: MBO MES; 1.8A {Archaeoglobus fulgidus} PDB: 2jhj_A (A:235-295)
Probab=24.98  E-value=40  Score=13.60  Aligned_cols=32  Identities=16%  Similarity=0.295  Sum_probs=23.3

Q ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHCCHHHHHH
Q ss_conf             78999987765206833236677412235789
Q gi|254781007|r   51 AWLQEVLDHVIYRTSPKNLYDLREAGRDNFIR   82 (411)
Q Consensus        51 awlqevldhviyrtspknlydlreagrdnfir   82 (411)
                      .|...++.+.-......+.-++++.+|+.|-+
T Consensus         7 VWIkrim~~~Y~~~~~~s~~~i~~f~r~~FG~   38 (61)
T 2jhn_A            7 LGVRRAVSRLYFNGEIQSAEKVREIARERFGR   38 (61)
T ss_dssp             HHHHHHHHHHHSTTCCCCHHHHHHHHHHHTGG
T ss_pred             HHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCC
T ss_conf             99999999970888899999999999875666


No 10 
>>2v6z_M DNA polymerase epsilon subunit 2; DNA replication, DPOE2, transferase, AAA protein family; HET: DNA; NMR {Homo sapiens} (M:)
Probab=23.32  E-value=40  Score=13.54  Aligned_cols=18  Identities=28%  Similarity=0.503  Sum_probs=8.2

Q ss_pred             CCHHHHHHHHHHHHHHHH
Q ss_conf             003330289999999985
Q gi|254781007|r  315 LSRSSVEKEKIEKVLQDC  332 (411)
Q Consensus       315 lsrssvekekiekvlqdc  332 (411)
                      |+-+-||++-||+.+|+|
T Consensus        81 Lss~~Ier~~iE~AVkEC   98 (99)
T 2v6z_M           81 LSSNMIERSVVEAAVQES   98 (99)
T ss_dssp             CSSSEECHHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHC
T ss_conf             981040399999999862


No 11 
>>3imo_A Integron cassette protein; novel, integron protein, argentinean O139 strain, unknown function; 1.80A {Vibrio cholerae O139} (A:)
Probab=23.24  E-value=43  Score=13.38  Aligned_cols=34  Identities=26%  Similarity=0.179  Sum_probs=17.6

Q ss_pred             HHHHHHCCCCHHEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             67876305903204425876534478987777787
Q gi|254781007|r  361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVIT  395 (411)
Q Consensus       361 ytlrqcasdpskyyeinsdenvmpiakslarnvit  395 (411)
                      -||+|.++.--.--+ ..-+||||||+.|+-.|+-
T Consensus        29 ~tL~~y~~~Vm~rA~-hh~g~V~~IalAL~gAIlw   62 (133)
T 3imo_A           29 NILSQYISGVMARAD-HHAGNVEEIALALAGAILW   62 (133)
T ss_dssp             HHHHHHHHHHHHHHH-HHCGGGHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH-HCCCCCHHHHHHHHHHEEE
T ss_conf             999999999987755-3615421789986112157


No 12 
>>2qjy_A Cytochrome B; cytochrome B, 8 TM helixces cytochrome C1, 1 C-TERM TM helix rieske; HET: BGL HEM SMA LOP UQ2; 2.40A {Rhodobacter sphaeroides} PDB: 2fyn_A* 2qjk_A* 2qjp_A* 1zrt_C* (A:123-226)
Probab=23.06  E-value=18  Score=16.04  Aligned_cols=50  Identities=28%  Similarity=0.398  Sum_probs=36.6

Q ss_pred             CHHHHHHHHHHHCCCCCEECCCCHHHHHHHEEEEEEEEEECCCCCHHHHHCCCCCCCHHCCHHHHHHH
Q ss_conf             52257898876187432002720234434122112578625862125654186421100060899988
Q gi|254781007|r  207 NRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVGTLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKN  274 (411)
Q Consensus       207 nrntlvknflsqipyknfcmapyhyssilywavgtltysvdnktttreyykdpyyatwdhfpysfikn  274 (411)
                      =..|...|++|.|||-        -.+|..|--|-  |||||.|-+|-+-        -||-..||--
T Consensus        35 WgAtVITnL~saiP~i--------G~~iv~wlwGG--fsV~n~TLnRFFs--------lH~llPfii~   84 (104)
T 2qjy_A           35 WGATVITGLFGAIPGI--------GHSIQTWLLGG--PAVDNATLNRFFS--------LHYLLPFVIA   84 (104)
T ss_dssp             HHHHHHHHHHHTSTTT--------HHHHHHHHHTS--SSSCHHHHHHHHH--------HHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCC--------CCCHHHEEECC--CCCCCCCHHHHHH--------HHHHHHHHHH
T ss_conf             4889998764116868--------87401012365--5578874227899--------9998899999


No 13 
>>2odp_A Complement C2; C3/C5 convertase, complement serine protease, human complement system, glycoprotein, SP, VWFA, hydrolase; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* (A:1-224)
Probab=22.13  E-value=45  Score=13.23  Aligned_cols=54  Identities=9%  Similarity=0.201  Sum_probs=36.9

Q ss_pred             HCCCCCEEEEEEEECCCCCCHHHHHHHHCCCCH---HEEEECCCCCHHHHHHHHHHH
Q ss_conf             114764168997404887420267876305903---204425876534478987777
Q gi|254781007|r  339 HRTGRDAITIFSVGFSPDQDTRYTLRQCASDPS---KYYEINSDENVMPIAKSLARN  392 (411)
Q Consensus       339 hrtgrdaitifsvgfspdqdtrytlrqcasdps---kyyeinsdenvmpiakslarn  392 (411)
                      -+.....|.||.+|+..+....-.|++.|+.+.   .|+.+.+....-.+...+...
T Consensus       156 ~~~~~~gi~i~~i~ig~~~~~~~~l~~ia~~~~g~~~~~~~~~~~~l~~~~~~i~~~  212 (224)
T 2odp_A          156 NQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQVFEHMLDV  212 (224)
T ss_dssp             CSTTGGGEEEEEEEESSSCCCHHHHHHHSCCCTTCCCEEEESSHHHHHHHHHHHEEC
T ss_pred             HHHHHCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHHHCC
T ss_conf             999866977999950586559999999863889872499958989999999875022


Done!