RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781008|ref|YP_003065421.1| hypothetical protein CLIBASIA_04550 [Candidatus Liberibacter asiaticus str. psy62] (99 letters) >gnl|CDD|182459 PRK10436, PRK10436, hypothetical protein; Provisional. Length = 462 Score = 29.1 bits (66), Expect = 0.28 Identities = 11/59 (18%), Positives = 22/59 (37%), Gaps = 13/59 (22%) Query: 21 TIPIGVLDSP-------------RSIRIQCWSAYKYKHQLHMSDLSDTVIDLPNHISII 66 T+ + V+D+P + I I+CW + + L + + V D + Sbjct: 27 TLHVAVVDAPSHELLDALRFATGKRIEIECWPRAQMEQHLQRTQQTLPVADQEKDTPVA 85 >gnl|CDD|150713 pfam10070, DUF2309, Uncharacterized protein conserved in bacteria (DUF2309). Members of this family of hypothetical bacterial proteins have no known function. Length = 783 Score = 28.0 bits (63), Expect = 0.60 Identities = 10/30 (33%), Positives = 14/30 (46%) Query: 70 EDMRLSSVVYATREDCQKILRALSEVSKLF 99 E +RL V+ A E ++IL V L Sbjct: 749 EPLRLLVVIEAPPEAIERILARHPAVRALV 778 >gnl|CDD|181042 PRK07575, PRK07575, dihydroorotase; Provisional. Length = 438 Score = 25.4 bits (56), Expect = 3.2 Identities = 12/50 (24%), Positives = 24/50 (48%), Gaps = 12/50 (24%) Query: 4 DVIIHSSIGEHDAKFDITIPIGVLDSPRSIRIQCWSAYKYKHQLHMSDLS 53 D HS I + +A +L + ++++ + KY+ +LH+ LS Sbjct: 197 DPADHSQIQDEEA--------ALLATRLALKL----SKKYQRRLHILHLS 234 >gnl|CDD|131034 TIGR01979, sufS, cysteine desulfurases, SufS subfamily. This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. Length = 403 Score = 25.3 bits (56), Expect = 4.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 73 RLSSVVYATREDCQKILRALSEVSKLF 99 R S +Y T ED ++ AL +V K F Sbjct: 376 RASFYIYNTEEDIDALVEALKKVRKFF 402 >gnl|CDD|178310 PLN02708, PLN02708, Probable pectinesterase/pectinesterase inhibitor. Length = 553 Score = 24.4 bits (53), Expect = 6.8 Identities = 11/35 (31%), Positives = 16/35 (45%), Gaps = 5/35 (14%) Query: 37 CWSAYKYKHQLH-----MSDLSDTVIDLPNHISII 66 CWSA KY + MS L + N +S++ Sbjct: 158 CWSALKYVNDTSQVNDTMSFLDSLIGLTSNALSMM 192 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.135 0.398 Gapped Lambda K H 0.267 0.0749 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,517,602 Number of extensions: 79555 Number of successful extensions: 135 Number of sequences better than 10.0: 1 Number of HSP's gapped: 135 Number of HSP's successfully gapped: 13 Length of query: 99 Length of database: 5,994,473 Length adjustment: 66 Effective length of query: 33 Effective length of database: 4,568,345 Effective search space: 150755385 Effective search space used: 150755385 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.0 bits)