RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781008|ref|YP_003065421.1| hypothetical protein CLIBASIA_04550 [Candidatus Liberibacter asiaticus str. psy62] (99 letters) >3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Length = 337 Score = 28.8 bits (64), Expect = 0.33 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 12/38 (31%) Query: 59 LPNHISIITCMEDMRLSSVVYATREDCQKILRALSEVS 96 L +HI R+S ED ++L AL+E S Sbjct: 309 LHHHI---------RIS---IGREEDNDRLLAALAEYS 334 >1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural genomics, PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Length = 406 Score = 28.2 bits (62), Expect = 0.51 Identities = 7/27 (25%), Positives = 14/27 (51%) Query: 73 RLSSVVYATREDCQKILRALSEVSKLF 99 R S +Y T E+ +++ L + +L Sbjct: 379 RASLAMYNTHEEVDRLVTGLQRIHRLL 405 >3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Length = 369 Score = 27.0 bits (59), Expect = 1.2 Identities = 7/27 (25%), Positives = 12/27 (44%), Gaps = 3/27 (11%) Query: 72 MRLSSVVYATREDCQKILRALSEVSKL 98 +R + E+ L A +E+ KL Sbjct: 344 LRTT---IGVPEENDAFLDAAAEIIKL 367 >3ly1_A Putative histidinol-phosphate aminotransferase; structural genomics, joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Length = 354 Score = 26.5 bits (58), Expect = 1.3 Identities = 6/26 (23%), Positives = 11/26 (42%), Gaps = 3/26 (11%) Query: 72 MRLSSVVYATREDCQKILRALSEVSK 97 R+S T ++ Q + + E K Sbjct: 328 CRIS---LGTPQEMQWVADTMREFRK 350 >1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Length = 420 Score = 26.1 bits (56), Expect = 1.9 Identities = 8/27 (29%), Positives = 13/27 (48%) Query: 73 RLSSVVYATREDCQKILRALSEVSKLF 99 R S Y T+E+ L++L + F Sbjct: 387 RASLYFYNTKEEIDLFLQSLQATIRFF 413 >3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), structural genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Length = 397 Score = 25.4 bits (54), Expect = 3.2 Identities = 7/47 (14%), Positives = 23/47 (48%) Query: 51 DLSDTVIDLPNHISIITCMEDMRLSSVVYATREDCQKILRALSEVSK 97 ++ + D ++S+ C++ +R+ + + RE + L+ + + Sbjct: 350 EVCKKLRDRGIYVSVCNCVKALRIVVMPHIKREHIDNFIEILNSIKR 396 >3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} Length = 361 Score = 24.7 bits (53), Expect = 4.7 Identities = 7/26 (26%), Positives = 10/26 (38%), Gaps = 3/26 (11%) Query: 72 MRLSSVVYATREDCQKILRALSEVSK 97 +R + + K LRAL V Sbjct: 337 VRFA---IKDEKKNTKFLRALKGVEN 359 >1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S beta lyase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Length = 384 Score = 24.8 bits (53), Expect = 4.8 Identities = 7/27 (25%), Positives = 12/27 (44%) Query: 73 RLSSVVYATREDCQKILRALSEVSKLF 99 R+S Y T E+ L+ + E+ Sbjct: 350 RISLCKYNTEEEVDYFLKKIEEILSFL 376 >3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis H37RV} Length = 406 Score = 24.7 bits (52), Expect = 5.4 Identities = 5/23 (21%), Positives = 13/23 (56%) Query: 73 RLSSVVYATREDCQKILRALSEV 95 + Y+T + +++RAL+ + Sbjct: 383 TVGLAHYSTMAEVDQLVRALASL 405 >3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria innocua CLIP11262, structural genomics, PSI-2, protein structure initiative; 2.31A {Listeria innocua} Length = 363 Score = 24.0 bits (51), Expect = 7.4 Identities = 5/37 (13%), Positives = 12/37 (32%), Gaps = 12/37 (32%) Query: 59 LPNHISIITCMEDMRLSSVVYATREDCQKILRALSEV 95 P + R++ ED ++ L ++ Sbjct: 338 FPTAV---------RIT---IGKEEDNSAVIALLEKL 362 >1u7l_A Vacuolar ATP synthase subunit C; hydrolase, structural protein; HET: TLA; 1.75A {Saccharomyces cerevisiae} SCOP: e.57.1.1 Length = 392 Score = 24.0 bits (52), Expect = 8.6 Identities = 15/85 (17%), Positives = 27/85 (31%), Gaps = 6/85 (7%) Query: 7 IHSSIGEHDAKFDITIPIGVLDSPRSIRIQCWSAYKYKHQLHMSDLSDTVIDLPNHISII 66 I + E T+PI + P + W K+K + DL + Sbjct: 85 ILQGLNETSTNAYRTLPINNMPVPEYLENFQWQTRKFKLDKSIKDLITLI-----SNESS 139 Query: 67 TCMEDMRLSSVVYAT-REDCQKILR 90 D+R + Y + + + R Sbjct: 140 QLDADVRATYANYNSAKTNLAAAER 164 >1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocysteine, aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Length = 390 Score = 24.0 bits (51), Expect = 8.6 Identities = 4/23 (17%), Positives = 8/23 (34%) Query: 73 RLSSVVYATREDCQKILRALSEV 95 R E+ +L L++ Sbjct: 366 RACCHYITDEEEINHLLARLADF 388 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.323 0.135 0.398 Gapped Lambda K H 0.267 0.0578 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 827,601 Number of extensions: 32524 Number of successful extensions: 127 Number of sequences better than 10.0: 1 Number of HSP's gapped: 127 Number of HSP's successfully gapped: 22 Length of query: 99 Length of database: 5,693,230 Length adjustment: 65 Effective length of query: 34 Effective length of database: 4,117,370 Effective search space: 139990580 Effective search space used: 139990580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.4 bits)