RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781010|ref|YP_003065423.1| hypothetical protein CLIBASIA_04560 [Candidatus Liberibacter asiaticus str. psy62] (195 letters) >gnl|CDD|38740 KOG3532, KOG3532, KOG3532, Predicted protein kinase [General function prediction only]. Length = 1051 Score = 29.3 bits (65), Expect = 0.72 Identities = 21/113 (18%), Positives = 48/113 (42%), Gaps = 15/113 (13%) Query: 57 TIFKTEVKRDIRRASRLSLEEKSKN---------ADKPTVIENQADNINIEVEVATNLNP 107 T K E ++ L++K+KN +P V + D+ ++ + T Sbjct: 323 THIKMEGGIEVTVLECSRLKDKNKNYEVYCTVTIESRPIVQNEEQDSQHVVNVLDTFSRY 382 Query: 108 NHQASEIDIAIENLPDLKSNHQASEIDIAIENLPDLKSNHQASEIDIAIENLP 160 + +S I + + K+ ++A ++ +N K+ + ++ +AI N+P Sbjct: 383 D-VSSPIGLVFD-----KNTNRAVKVCTVEDNSLADKAAFKPGDVLVAINNVP 429 >gnl|CDD|176148 cd08459, PBP2_DntR_NahR_LinR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold. This CD includes LysR-like bacterial transcriptional regulators, DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. DntR from Burkholderia species controls genes encoding enzymes for oxidative degradation of the nitro-aromatic compound 2,4-dinitrotoluene. The active form of DntR is homotetrameric, consisting of a dimer of dimers. NahR is a salicylate-dependent transcription activator of the nah and sal operons for naphthalene degradation. Salicylic acid is an intermediate of the oxidative degradation of the aromatic ring in soil bacteria. LinR positively regulates expression of the genes (linD and linE) encoding enzymes for gamma-hexachlorocyclohexane (a haloorganic insecticide) degradation. Expression of linD and linE are induced by their substrates, 2,5-dichlorohydroquinone (2,5-DCHQ) and chlorohydroquinone (CHQ). The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Length = 201 Score = 27.5 bits (62), Expect = 2.1 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Query: 110 QASEIDIAIENLP--DLKSNHQASEIDIAIENLPDLK 144 A + I LP +L+ ++ EID+AI LPDL Sbjct: 25 VAPGVRIETVRLPVDELEEALESGEIDLAIGYLPDLG 61 >gnl|CDD|143851 pfam00069, Pkinase, Protein kinase domain. Length = 260 Score = 27.6 bits (62), Expect = 2.2 Identities = 10/34 (29%), Positives = 16/34 (47%), Gaps = 7/34 (20%) Query: 1 MKSKNILIVSTLVICVLSISSCDLGDSIAKKRNT 34 +K +NIL+ V+ + D G +AKK Sbjct: 124 LKPENILLDENGVVKI-----ADFG--LAKKLEK 150 >gnl|CDD|35157 COG5598, COG5598, Trimethylamine:corrinoid methyltransferase [Coenzyme metabolism]. Length = 526 Score = 27.2 bits (60), Expect = 3.3 Identities = 12/47 (25%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Query: 150 SEIDIAIENLPDHQVDRN-----HTLSNLRGACYQPSLVSNSSLKLW 191 SE +A + + + + HTL+ + A Y P L S + W Sbjct: 428 SEEALAFDAIREVGPGGHFLGCPHTLALYQTAFYDPMLADRRSFEQW 474 >gnl|CDD|39006 KOG3802, KOG3802, KOG3802, Transcription factor OCT-1, contains POU and HOX domains [Transcription]. Length = 398 Score = 26.2 bits (57), Expect = 5.3 Identities = 7/24 (29%), Positives = 14/24 (58%) Query: 30 KKRNTIGNTIKKSINRVIQENNKP 53 KKR +I ++ ++ + +N KP Sbjct: 296 KKRTSIEVNVRGALEKHFLKNPKP 319 >gnl|CDD|34887 COG5296, COG5296, Transcription factor involved in TATA site selection and in elongation by RNA polymerase II [Transcription]. Length = 521 Score = 25.5 bits (55), Expect = 8.9 Identities = 10/47 (21%), Positives = 22/47 (46%) Query: 38 TIKKSINRVIQENNKPRNMTIFKTEVKRDIRRASRLSLEEKSKNADK 84 I K + + + K N+ KTE+++ +RA L ++ + + Sbjct: 345 EISKMVACKDEVHPKRSNVIHEKTELRQKRQRAIELKNKKAAMEYQR 391 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.312 0.128 0.347 Gapped Lambda K H 0.267 0.0706 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,031,269 Number of extensions: 95380 Number of successful extensions: 182 Number of sequences better than 10.0: 1 Number of HSP's gapped: 180 Number of HSP's successfully gapped: 16 Length of query: 195 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 106 Effective length of database: 4,340,536 Effective search space: 460096816 Effective search space used: 460096816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 55 (25.0 bits)