RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781010|ref|YP_003065423.1| hypothetical protein CLIBASIA_04560 [Candidatus Liberibacter asiaticus str. psy62] (195 letters) >gnl|CDD|132260 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semialdehyde dehydrogenase. Members of this protein family are 2-hydroxymuconic semialdehyde dehydrogenase. Many aromatic compounds are catabolized by way of the catechol, via the meta-cleavage pathway, to pyruvate and acetyl-CoA. This enzyme performs the second of seven steps in that pathway for catechol degradation. Length = 481 Score = 29.3 bits (66), Expect = 0.69 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 9/58 (15%) Query: 69 RASRLSLE---EKSKNADKPTVIENQADNIN------IEVEVATNLNPNHQASEIDIA 117 A+R +L+ K A++ ++ AD I + EVA P AS +DI Sbjct: 43 AAARAALKGPWGKMTVAERADLLYAVADEIERRFDDFLAAEVADTGKPRSLASHLDIP 100 >gnl|CDD|179522 PRK02998, prsA, peptidylprolyl isomerase; Reviewed. Length = 283 Score = 28.8 bits (64), Expect = 0.93 Identities = 18/100 (18%), Positives = 48/100 (48%), Gaps = 6/100 (6%) Query: 1 MKSKNILIVSTLVICVLSISSCDLGDSIAKKRNTIGNTIKKSINRVIQENNKPRNMTIFK 60 MK K + + + + VL++S+C D++ + +GN +K +++ +++ + ++ Sbjct: 1 MKKKKLFLGTIISCVVLALSACGSSDNVVTSK--VGNITEKELSKELRQKYGESTL--YQ 56 Query: 61 TEVKRDIRRASRLSLEEKSKNADKPTVIENQADNINIEVE 100 + + + ++S EE K ++ + DN +E Sbjct: 57 MVLSKALLDKYKVSDEEAKKQVEEAK--DKMGDNFKSTLE 94 >gnl|CDD|114945 pfam06253, MTTB, Trimethylamine methyltransferase (MTTB). This family consists of several trimethylamine methyltransferase (MTTB) (EC:2.1.1.-) proteins from numerous Rhizobium and Methanosarcina species. Length = 505 Score = 28.1 bits (63), Expect = 1.7 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 168 HTLSNLRGACYQPSLVSNSSLKLW 191 HTL+ + A YQP+L ++ + W Sbjct: 434 HTLARYQTAFYQPALSDWNNFEQW 457 >gnl|CDD|178848 PRK00081, coaE, dephospho-CoA kinase; Reviewed. Length = 197 Score = 27.8 bits (63), Expect = 1.7 Identities = 14/60 (23%), Positives = 27/60 (45%), Gaps = 10/60 (16%) Query: 43 INRVIQENNKPRNMTIFKTEVKRDIRRASRLSLEEKSKNADKPTVIENQADNINIEVEVA 102 + R++ + ++ + E + AS++ EEK AD VI+N D + +V Sbjct: 139 LERLMARDG----LS--EEEAEA--IIASQMPREEKLARADD--VIDNNGDLEELRKQVE 188 >gnl|CDD|162713 TIGR02122, TRAP_TAXI, TRAP transporter solute receptor, TAXI family. This family is one of at least three major families of extracytoplasmic solute receptor (ESR) for TRAP (Tripartite ATP-independent Periplasmic Transporter) transporters. The others are the DctP (TIGR00787) and SmoM (pfam03480) families. These transporters are secondary (driven by an ion gradient) but composed of three polypeptides, although in some species the 4-TM and 12-TM integral membrane proteins are fused. Substrates for this transporter family are not fully characterized but, besides C4 dicarboxylates, may include mannitol and other compounds. Length = 320 Score = 27.7 bits (62), Expect = 2.3 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Query: 118 IENLPDLKSNHQASE---IDIAIENLP 141 ENL +LK H A++ ++ AI+ LP Sbjct: 279 FENLDELKDAHPAAQDIALETAIKGLP 305 Score = 27.7 bits (62), Expect = 2.3 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Query: 137 IENLPDLKSNHQASE---IDIAIENLP 160 ENL +LK H A++ ++ AI+ LP Sbjct: 279 FENLDELKDAHPAAQDIALETAIKGLP 305 >gnl|CDD|132375 TIGR03332, salvage_mtnW, 2,3-diketo-5-methylthiopentyl-1-phosphate enolase. Members of this family are the methionine salvage pathway enzyme 2,3-diketo-5-methylthiopentyl-1-phosphate enolase, a homolog of RuBisCO. This protein family seems restricted to Bacillus subtilis and close relatives, where two separate proteins carry the enolase and phosphatase activities that in other species occur in a single protein, MtnC (TIGR01691). Length = 407 Score = 27.1 bits (60), Expect = 3.0 Identities = 8/25 (32%), Positives = 16/25 (64%) Query: 43 INRVIQENNKPRNMTIFKTEVKRDI 67 I +++ + +P M+IFK + RD+ Sbjct: 130 IRKLLGVHERPLLMSIFKGMIGRDL 154 >gnl|CDD|162742 TIGR02171, Fb_sc_TIGR02171, Fibrobacter succinogenes paralogous family TIGR02171. This model describes a paralogous family of the rumen bacterium Fibrobacter succinogenes. Eleven members are found in Fibrobacter succinogenes S85, averaging over 900 amino acids in length. More than half are predicted lipoproteins. The function is unknown. Length = 912 Score = 26.3 bits (58), Expect = 5.6 Identities = 11/52 (21%), Positives = 16/52 (30%), Gaps = 8/52 (15%) Query: 117 AIENLPDLKSNHQASEIDIAIENLPDLKSNHQASEIDIAIENLPDHQVDRNH 168 AI + LK + +E D N + + P D NH Sbjct: 698 AIPHAKKLKY--------VVVELSLDFWWNTATEDTNAKYLLYPGFVYDENH 741 >gnl|CDD|139579 PRK13448, atpC, F0F1 ATP synthase subunit epsilon; Provisional. Length = 135 Score = 26.3 bits (58), Expect = 5.6 Identities = 11/39 (28%), Positives = 13/39 (33%), Gaps = 4/39 (10%) Query: 111 ASEIDIAIENLPDLKSNHQASEIDIAIENLPDLKSNHQA 149 A+ I L E+D AIE L KS Sbjct: 94 AATIAEMEAQLA----GKVGDELDRAIERLDHFKSIQHQ 128 Score = 25.9 bits (57), Expect = 7.3 Identities = 8/24 (33%), Positives = 9/24 (37%) Query: 107 PNHQASEIDIAIENLPDLKSNHQA 130 E+D AIE L KS Sbjct: 105 AGKVGDELDRAIERLDHFKSIQHQ 128 >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated. Length = 429 Score = 26.0 bits (57), Expect = 7.0 Identities = 16/76 (21%), Positives = 30/76 (39%), Gaps = 4/76 (5%) Query: 29 AKKRNTIGNTIKKSINRVIQENNKPRNMTIFKTEVKRDIRRASRLSLEEKSKNADKPTVI 88 KK I + + + +E + R + + +R +A + L + S N D P+ Sbjct: 346 RKKE--IAQKRRAAEREINREARQERAAAMARARARRAAVKAKKKGLIDASPNEDTPS-- 401 Query: 89 ENQADNINIEVEVATN 104 EN+ + AT Sbjct: 402 ENEESKGSPPQVEATT 417 >gnl|CDD|150614 pfam09960, DUF2194, Uncharacterized protein conserved in bacteria (DUF2194). This domain, found in various hypothetical bacterial proteins, has no known function. Length = 573 Score = 25.9 bits (57), Expect = 7.9 Identities = 13/53 (24%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Query: 112 SEIDIAIENLPDLKSNHQASEIDIAIENLPDLKS--NHQASEIDIAIENLPDH 162 S + I +N P L+ N SE A++ LK + ++++I ++N + Sbjct: 494 SFLYIIKKNYPWLR-NMTGSEAANAVKRYFTLKPFIKYTDNKLEIDLKNFHNL 545 >gnl|CDD|150572 pfam09916, DUF2145, Uncharacterized protein conserved in bacteria (DUF2145). This domain, found in various hypothetical prokaryotic proteins, has no known function. Length = 200 Score = 25.7 bits (57), Expect = 8.0 Identities = 10/27 (37%), Positives = 12/27 (44%) Query: 164 VDRNHTLSNLRGACYQPSLVSNSSLKL 190 DR + LR A YQP + LK Sbjct: 137 DDRAQAQAWLRLAYYQPQPLHIGPLKR 163 >gnl|CDD|179323 PRK01710, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional. Length = 458 Score = 25.8 bits (57), Expect = 8.0 Identities = 9/16 (56%), Positives = 13/16 (81%) Query: 94 NINIEVEVATNLNPNH 109 +++ EV V TNL+PNH Sbjct: 182 DVSPEVAVVTNLSPNH 197 >gnl|CDD|179310 PRK01622, PRK01622, OxaA-like protein precursor; Validated. Length = 256 Score = 25.5 bits (56), Expect = 8.3 Identities = 8/22 (36%), Positives = 14/22 (63%) Query: 1 MKSKNILIVSTLVICVLSISSC 22 +KS ++VS ++ VL +S C Sbjct: 2 LKSYRAVLVSLSLLLVLVLSGC 23 >gnl|CDD|165155 PHA02792, PHA02792, ankyrin-like protein; Provisional. Length = 631 Score = 25.7 bits (56), Expect = 9.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Query: 29 AKKRNTIGNTIKKSINRVIQENNKPRNMTIFKTEVKRDIRRASRLSLE 76 AKK+ N I + N++I+++ K NM EV D R S L LE Sbjct: 576 AKKQYKFYNQIIYNANKLIEQSKKIDNMI---DEVSADNNRLSTLPLE 620 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.312 0.128 0.347 Gapped Lambda K H 0.267 0.0628 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,857,601 Number of extensions: 169461 Number of successful extensions: 296 Number of sequences better than 10.0: 1 Number of HSP's gapped: 294 Number of HSP's successfully gapped: 39 Length of query: 195 Length of database: 5,994,473 Length adjustment: 88 Effective length of query: 107 Effective length of database: 4,092,969 Effective search space: 437947683 Effective search space used: 437947683 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 54 (24.8 bits)